Detailed information of auxiliary protein
Auxiliary protein
| ID | 388 | GenBank | WP_012816542 |
| Name | SmpO  |
UniProt ID | D2J7N1 |
| Length | 84 a.a. | PDB ID | _ |
| Note | (1) SmpO auxiliary protein binds ossA and ossB of oriTpWBG749 [PMID:33939800]. (2) An F7K amino substitution of SmpO auxiliary protein switched oriT-binding specificity in vitro and reduced the self-transfer of pWBG749 in vivo [PMID:33939800]. |
||
Protein sequence
Download Length: 84 a.a. Molecular weight: 9898.20 Da Isoelectric Point: 5.1035
>WP_012816542.1 hypothetical protein [Staphylococcus aureus]
MPTKDIFIRNVNVDTLERIDRLAKQKNISRNDFLLGIIEQVDPLECYRSLYAEQSHQQAQNTKALKELAD
KIDRVYNTINDLEY
MPTKDIFIRNVNVDTLERIDRLAKQKNISRNDFLLGIIEQVDPLECYRSLYAEQSHQQAQNTKALKELAD
KIDRVYNTINDLEY
Protein domains
No domain identified.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | D2J7N1 |
Reference
[1] Frances G O'Brien et al. (2015) Origin-of-transfer sequences facilitate mobilisation of non-conjugative antimicrobial-resistance plasmids in Staphylococcus aureus.. Nucleic acids research. 43(16):7971-83. [PMID:26243776]