Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101006
Name   oriT_pLS20 experimental
Organism   Bacillus subtilis subsp. natto
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_015148 (27531..27892 [+], 362 nt)
oriT length   362 nt
IRs (inverted repeats)      IR1: 153..161, 199..207  (CTGGTACCA..TGGTGCCAG)
  IR2: 171..177, 181..187  (AAACCGC..GCGGTTT)
Location of nic site      264..265
Conserved sequence flanking the
  nic site    		  GGGCCGGC|T
Note   

  oriT sequence  


Download         Length: 362 nt

>oriT_pLS20
AAAGAGCAATCTCGTCATCGAAGACTAAATTTCTGTATGGAAAACAGTTATTTTTCGTGTGCATAAAATAAAGATTTATGTGCATTTAGTTCTAAATCACCTAAATAATGGTTGAACATAAATGTTTTTTTTATGTGCATTCAGCAATAAATCTGGTACCACGAAAAAACAAACCGCACTGCGGTTTCACCATGCAAATGGTGCCAGTTTCCCCTTATGCTCTTTCCTTTTCCACCCCCTCCTTCCTTCGGAATCGGGGGCCGGCTTTTTGCTGCCGCAAAAAGCCTTGGAAAAAGAAACACTTATTTGAACAGATCGTTGCAAAGTAATGTGCAGAAATCGATGAAAAGGAGCGTTAACAA

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Gayetri Ramachandran et al. (2017) Discovery of a new family of relaxases in Firmicutes bacteria. PLoS genetics. 13(2):e1006586. [PMID:28207825]


Relaxosome

This oriT is a component of a relaxosome.

Relaxosome name   RelaxosomepLS20 experimental
oriT   oriT_pLS20 experimental
Relaxase   RelLS20 experimental (MOBL)
Auxiliary protein   Aux1LS20 experimental, Aux2LS20 experimental

  Reference


[1] Isidro Crespo et al. (2022) Structural and biochemical characterization of the relaxosome auxiliary proteins encoded on the Bacillus subtilis plasmid pLS20. Computational and structural biotechnology journal. 20:757-765. [PMID:35198129]
[2] Gayetri Ramachandran et al. (2017) Discovery of a new family of relaxases in Firmicutes bacteria. PLoS genetics. 13(2):e1006586. [PMID:28207825]
[3] Andrés Miguel-Arribas et al. (2017) The Bacillus subtilis Conjugative Plasmid pLS20 Encodes Two Ribbon-Helix-Helix Type Auxiliary Relaxosome Proteins That Are Essential for Conjugation. Frontiers in microbiology. 1.818055556. [PMID:29163424]


Relaxase

ID   1074 GenBank   WP_013603221
Name   RelLS20 experimental UniProt ID   E9RJ23
Length   410 a.a. PDB ID   
Note   

  Relaxase protein sequence


Download         Length: 410 a.a.        Molecular weight: 48596.08 Da        Isoelectric Point: 10.0206

>WP_013603221.1 MULTISPECIES: MobP2 family relaxase [Bacillaceae]
MDSPGVVLVSKYVSGKSTKFSKYVNYINRDEAVRTEKFQTYNVNKLDGYNQYMGNPEKSSGIFTQHKDSL
SPVEKNQLKEIFRQAQKNDSVMWQDVISFDNKWLEERGIYNSQTGWVNEGAIQNSIRKGMEVLLREEQLE
QSGVWSAAIHYNTDNIHVHIALVEPNPTKEYGVFTNKKTGEVYQARRGNRKLKTLDKMKSKVANTLMDRD
KELSKISQLIHDRIAPKGLKFQPRLDTYMTKMYNHIYENLPEDMRLWKYNNNALNNIRPEIDSVITMYIQ
KYHPEDYKELDQSLKEEMEFRKSVYGDGPKQVERYKEYRKNKHKELYTKLGNSMLKEMAEIRRRESQSKQ
MNRSGTYAPSSVSNRQWDTKGRRIKRSDINKIKHALDKDYQSMKNMRKYQQMQYEMEQSR

  Protein domains


Predicted by InterproScan.

MobL relaxases (MobL)

(3-389)


  Protein structure


Source ID Structure
AlphaFold DB E9RJ23

  Reference


[1] Gayetri Ramachandran et al. (2017) Discovery of a new family of relaxases in Firmicutes bacteria. PLoS genetics. 13(2):e1006586. [PMID:28207825]


Host bacterium

ID   1465 GenBank   NC_015148
Plasmid name   pLS20 Incompatibility group   -
Plasmid size   65774 bp Coordinate of oriT [Strand]   27531..27892 [+]
Host baterium   Bacillus subtilis subsp. natto

Cargo genes

Drug resistance gene   cat(pC194)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -