Detailed information of auxiliary protein

Auxiliary protein


ID   387 GenBank   WP_013603219
Name   Aux2LS20 experimental UniProt ID   E9RJ21
Length   79 a.a. PDB ID   _
Note   

  Protein sequence


Download         Length: 79 a.a.        Molecular weight: 8868.14 Da        Isoelectric Point: 5.8451

>WP_013603219.1 MULTISPECIES: hypothetical protein [Bacillaceae]
MPDLNIKGLSKDTMNRLADKARKAGLSQQEYLRQLLDKHVVADEVEGVRSELGEVIKSVAFALEQNTKVL
NEFIRVNEG

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB E9RJ21

  Reference


[1] Andrés Miguel-Arribas et al. (2017) The Bacillus subtilis Conjugative Plasmid pLS20 Encodes Two Ribbon-Helix-Helix Type Auxiliary Relaxosome Proteins That Are Essential for Conjugation.. Frontiers in microbiology. 1.818055556. [PMID:29163424]