Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100017
Name   oriT_R64 experimental
Organism   Salmonella enterica subsp. enterica serovar Typhimurium
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_005014 (_)
oriT length   92 nt
IRs (inverted repeats)      8..bp: 6..13, 17..24  (GTCGGGGC..GCCCTGAC)
 17..bp: 31..47, 54..70  (GCAATTGTAATAGCGTC..GACGGTATTACAATTGC)
Location of nic site      78..79
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   minimal oriT sequence

  oriT sequence  


Download         Length: 92 nt

>oriT_R64
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCGGG

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Furuya N et al. (1991) Determination of the nick site at oriT of IncI1 plasmid R64: global similarity of oriT structures of IncI1 and IncP plasmids. J Bacteriol. 173(20):6612-7. [PMID:1917882]
[2] Komano T et al. (1990) Transfer region of IncI1 plasmid R64 and role of shufflon in R64 transfer. J Bacteriol. 172(5):2230-5. [PMID:1970558]


Relaxosome


This oriT is a component of a relaxosome.

Relaxosome name   RelaxosomeR64 in_silico
oriT   oriT_R64 experimental
Relaxase   NikB_R64 experimental (MOBP)
Auxiliary protein   NikA_R64 experimental

  Reference


[1] Furuya N et al. (1991) Determination of the nick site at oriT of IncI1 plasmid R64: global similarity of oriT structures of IncI1 and IncP plasmids. J Bacteriol. 173(20):6612-7. [PMID:1917882]
[2] Komano T et al. (1990) Transfer region of IncI1 plasmid R64 and role of shufflon in R64 transfer. J Bacteriol. 172(5):2230-5. [PMID:1970558]


Relaxase


ID   16 GenBank   NP_863436
Name   NikB_R64 experimental UniProt ID   Q79VV7
Length   899 a.a. PDB ID   
Note   to recognize the conserved nick region sequence

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104010.41 Da        Isoelectric Point: 7.4265

>NP_863436.1 hypothetical protein R64_p081 (plasmid) [Salmonella enterica subsp. enterica serovar Typhimurium]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELNLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure


Source ID Structure
AlphaFold DB Q79VV7

  Reference


[1] Furuya N et al. (1991) Determination of the nick site at oriT of IncI1 plasmid R64: global similarity of oriT structures of IncI1 and IncP plasmids. J Bacteriol. 173(20):6612-7. [PMID:1917882]


Auxiliary protein


ID   26 GenBank   NP_863435
Name   NikA_R64 experimental UniProt ID   Q79VV8
Length   110 a.a. PDB ID   _
Note   an oriT-binding protein (to recognize the 17-bp repeat A sequence)

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>NP_863435.1 hypothetical protein R64_p080 (plasmid) [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB Q79VV8

  Reference


[1] Furuya N et al. (1991) Determination of the nick site at oriT of IncI1 plasmid R64: global similarity of oriT structures of IncI1 and IncP plasmids. J Bacteriol. 173(20):6612-7. [PMID:1917882]


T4CP


ID   16 GenBank   NP_863437
Name   TrbC_R64 experimental UniProt ID   Q79VV6
Length   763 a.a. PDB ID   _
Note   NP_863437 hypothetical protein R64_p082 (plasmid) [Salmonella enterica subsp. enterica serovar Typhimurium]

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86941.11 Da        Isoelectric Point: 6.7713

>NP_863437.1 hypothetical protein R64_p082 (plasmid) [Salmonella enterica subsp. enterica serovar Typhimurium]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKTNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB Q79VV6

  Reference


[1] Ding Z et al. (2003) The outs and ins of bacterial type IV secretion substrates. Trends Microbiol. 11(11):527-35. [PMID:14607070]


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 72411..110720

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QBL16_RS00405 (R64_p082) 70127..72418 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
QBL16_RS00410 (R64_p083) 72411..73481 - 1071 WP_000151582 IncI1-type conjugal transfer protein TrbB trbB
QBL16_RS00415 (R64_p084) 73500..74708 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
QBL16_RS00420 (R64_p086) 75000..75152 + 153 WP_001331364 Hok/Gef family protein -
QBL16_RS00425 (R64_RS00430) 75224..75475 - 252 WP_001291964 hypothetical protein -
QBL16_RS00430 75974..76069 + 96 WP_001303310 DinQ-like type I toxin DqlB -
QBL16_RS00435 (R64_RS00435) 76134..76310 - 177 WP_001054897 hypothetical protein -
QBL16_RS00440 (R64_RS00440) 76702..76911 + 210 WP_000062603 HEAT repeat domain-containing protein -
QBL16_RS00445 (R64_p087) 76983..77645 - 663 WP_000644796 plasmid IncI1-type surface exclusion protein ExcA -
QBL16_RS00450 (R64_p089) 77716..79884 - 2169 WP_000698354 DotA/TraY family protein traY
QBL16_RS00455 (R64_p090) 79981..80565 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
QBL16_RS00460 (R64_p091) 80594..81796 - 1203 WP_001385654 IncI1-type conjugal transfer protein TraW traW
QBL16_RS00465 (R64_p092) 81763..82377 - 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
QBL16_RS00470 (R64_p093) 82377..85421 - 3045 WP_001024780 IncI1-type conjugal transfer protein TraU traU
QBL16_RS00475 (R64_p094) 85511..86311 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
QBL16_RS00480 (R64_p095) 86295..86483 - 189 WP_001277255 putative conjugal transfer protein TraS -
QBL16_RS00485 (R64_p096) 86547..86951 - 405 WP_000086958 IncI1-type conjugal transfer protein TraR traR
QBL16_RS00490 (R64_p097) 87002..87529 - 528 WP_001055569 conjugal transfer protein TraQ traQ
QBL16_RS00495 (R64_p098) 87529..88233 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
QBL16_RS00500 (R64_p099) 88233..89522 - 1290 WP_001272003 conjugal transfer protein TraO traO
QBL16_RS00505 (R64_p100) 89525..90508 - 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
QBL16_RS00510 (R64_p101) 90519..91211 - 693 WP_000138550 DotI/IcmL family type IV secretion protein traM
QBL16_RS00515 (R64_p102) 91208..91555 - 348 WP_001055900 conjugal transfer protein traL
QBL16_RS00520 (R64_p103) 91573..95340 - 3768 WP_011117609 LPD7 domain-containing protein -
QBL16_RS00525 (R64_p105) 95430..95981 - 552 WP_000014583 phospholipase D family protein -
QBL16_RS00530 (R64_p106) 95996..96286 - 291 WP_011117611 hypothetical protein traK
QBL16_RS00535 (R64_p107) 96283..97431 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
QBL16_RS00540 (R64_p108) 97428..98246 - 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
QBL16_RS00545 (R64_p109) 98243..98701 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
QBL16_RS00550 (R64_p110) 99096..99680 - 585 WP_000977522 histidine phosphatase family protein -
QBL16_RS00555 (R64_p111) 99740..100942 - 1203 WP_000976351 conjugal transfer protein TraF -
QBL16_RS00560 (R64_p112) 101027..101851 - 825 WP_001238939 conjugal transfer protein TraE traE
QBL16_RS00565 (R64_p113) 102002..103156 - 1155 WP_001139957 site-specific integrase -
QBL16_RS00570 (R64_p114) 103140..103466 + 327 WP_001213803 hypothetical protein -
QBL16_RS00665 (R64_p119) 104572..104793 + 222 Protein_114 prepilin -
QBL16_RS00575 (R64_p120) 104790..106214 - 1425 WP_001389385 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
QBL16_RS00580 (R64_p121) 106214..106870 - 657 WP_001193553 prepilin peptidase -
QBL16_RS00585 (R64_p122) 106855..107415 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
QBL16_RS00590 (R64_p123) 107425..108039 - 615 WP_001696543 type 4 pilus major pilin -
QBL16_RS00595 (R64_p124) 108057..109154 - 1098 WP_001208805 type II secretion system F family protein -
QBL16_RS00600 (R64_p125) 109167..110720 - 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
QBL16_RS00605 (R64_p126) 110731..111183 - 453 WP_001247336 type IV pilus biogenesis protein PilP -
QBL16_RS00610 (R64_p127) 111170..112465 - 1296 WP_001696544 type 4b pilus protein PilO2 -
QBL16_RS00615 (R64_p128) 112458..114140 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
QBL16_RS00620 (R64_p129) 114154..114591 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
QBL16_RS00625 (R64_p130) 114591..115658 - 1068 WP_000742600 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   16 GenBank   NC_005014
Plasmid name   R64 Incompatibility group   IncI1
Plasmid size   120826 bp Coordinate of oriT [Strand]   66951..67033 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Typhimurium

Cargo genes


Drug resistance gene   tet(B), aph(3'')-Ib, aph(6)-Id
Virulence gene   -
Metal resistance gene   arsR, arsD, arsA, arsB, arsC, arsH
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -