Detailed information of auxiliary protein

Auxiliary protein


ID   26 GenBank   NP_863435
Name   NikA_R64  experimental UniProt ID   Q79VV8
Length   110 a.a. PDB ID   _
Note   an oriT-binding protein (to recognize the 17-bp repeat A sequence)

  Protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>NP_863435.1 hypothetical protein R64_p080 (plasmid) [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB Q79VV8

  Reference


[1] Furuya N et al. (1991) Determination of the nick site at oriT of IncI1 plasmid R64: global similarity of oriT structures of IncI1 and IncP plasmids. J Bacteriol. 173(20):6612-7. [PMID:1917882]