Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100009
Name   oriT_R1162 experimental
Organism   Pseudomonas aeruginosa
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   M13380 (111..270 [+], 160 nt)
oriT length   160 nt
IRs (inverted repeats)      IR1: 3..12, 16..25  (CCAGTTTCTC..GAGAAACCGG)
  IR2: 39..44, 48..53  (CCCTAC..GTAGGG)
Location of nic site      33..34
Conserved sequence flanking the
  nic site    		  TAAATGCG|CCCT
Note   (1) Tyr25 residue of the relaxase MobA_R1162 is essential for catalytic activity [PMID:17157875].
 (2) The relaxase MobA_R1162 contains two, auxiliary protein MobB_R1162-dependent type IV transport signals [PMID:17880426].
 (3) The N-terminal and C-terminal of relaxase MobA_R1162 are independently transported by the type IV pathway [PMID:17880426].

  oriT sequence  


Download         Length: 160 nt

>oriT_R1162
GGCCAGTTTCTCGAAGAGAAACCGGTAAATGCGCCCTCCCCTACAAAGTAGGGTCGGGATTGCCGCCGCTGTGCCTCCATGATAGCCTACGAGACAGCACATTAACAATGGGGTGTCAAGATGGTTAAGGGGAGCAACAAGGCGGCGGATCGGCTGGCCA

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] de la Cruz F et al. (2010) Conjugative DNA metabolism in Gram-negative bacteria. FEMS Microbiol Rev. 34(1):18-40. [PMID:19919603]
[2] Meyer R (2009) The R1162 mob proteins can promote conjugative transfer from cryptic origins in the bacterial chromosome. J Bacteriol. 191(5):1574-80. [PMID:19074386]
[3] Jandle S et al. (2006) Stringent and relaxed recognition of oriT by related systems for plasmid mobilization: implications for horizontal gene transfer. J Bacteriol. 188(2):499-506. [PMID:16385040]
[4] Parker C et al. (2005) Elements in the co-evolution of relaxases and their origins of transfer. Plasmid . 53(2):113-8. [PMID:15737398]
[5] Becker EC et al. (2003) Relaxed specificity of the R1162 nickase: a model for evolution of a system for conjugative mobilization of plasmids. J Bacteriol. 185(12):3538-46. [PMID:12775691]
[6] Zhang S et al. (1997) The relaxosome protein MobC promotes conjugal plasmid mobilization by extending DNA strand separation to the nick site at the origin of transfer. Mol Microbiol. 25(3):509-16. [PMID:9302013]
[7] Brasch MA et al. (1986) Genetic organization of plasmid R1162 DNA involved in conjugative mobilization. J Bacteriol. 167(2):703-10. [PMID:3525520]


Relaxosome

This oriT is a component of a relaxosome.

Relaxosome name   RelaxosomeR1162 experimental
oriT   oriT_R1162 experimental
Relaxase   MobA_R1162 experimental (MOBQ)
Auxiliary protein   MobB_R1162 experimental, MobC_R1162 experimental

  Reference


[1] de la Cruz F et al. (2010) Conjugative DNA metabolism in Gram-negative bacteria. FEMS Microbiol Rev. 34(1):18-40. [PMID:19919603]
[2] Meyer R (2009) The R1162 mob proteins can promote conjugative transfer from cryptic origins in the bacterial chromosome. J Bacteriol. 191(5):1574-80. [PMID:19074386]
[3] Parker C et al. (2007) The R1162 relaxase/primase contains two, type IV transport signals that require the small plasmid protein MobB. Mol Microbiol. 66(1):252-61. [PMID:17880426]
[4] Jandle S et al. (2006) Stringent and relaxed recognition of oriT by related systems for plasmid mobilization: implications for horizontal gene transfer. J Bacteriol. 188(2):499-506. [PMID:16385040]
[5] Parker C et al. (2005) Elements in the co-evolution of relaxases and their origins of transfer. Plasmid . 53(2):113-8. [PMID:15737398]
[6] Xiaolin Zhang et al. (2003) Molecular handcuffing of the relaxosome at the origin of conjugative transfer of the plasmid R1162. Nucleic acids research. 31(16):4762-8. [PMID:12907717]
[7] Becker EC et al. (2003) Relaxed specificity of the R1162 nickase: a model for evolution of a system for conjugative mobilization of plasmids. J Bacteriol. 185(12):3538-46. [PMID:12775691]
[8] Zhang S et al. (1997) The relaxosome protein MobC promotes conjugal plasmid mobilization by extending DNA strand separation to the nick site at the origin of transfer. Mol Microbiol. 25(3):509-16. [PMID:9302013]
[9] Brasch MA et al. (1986) Genetic organization of plasmid R1162 DNA involved in conjugative mobilization. J Bacteriol. 167(2):703-10. [PMID:3525520]


Relaxase

ID   8 GenBank   P07112
Name   MobA_R1162 experimental UniProt ID   P07112
Length   709 a.a. PDB ID   
Note   (1) Tyr25 residue of the relaxase MobA_R1162 is essential for catalytic activity [PMID:17157875].
 (2) The relaxase MobA_R1162 contains two, auxiliary protein MobB_R1162-dependent type IV transport signals [PMID:17880426].
 (3) The N-terminal and C-terminal of relaxase MobA_R1162 are independently transported by the type IV pathway [PMID:17880426].

  Relaxase protein sequence


Download         Length: 709 a.a.        Molecular weight: Da        Isoelectric Point:

>sp|P07112.4|MOBA2_ECOLX RecName: Full=Mobilization protein A; AltName: Full=DNA strand transferase; Includes: RecName: Full=DNA relaxase; AltName: Full=DNA nickase; Includes: RecName: Full=DNA primase
MAIYHLTAKTGSRSGGQSARAKADYIQREGKYARDMDEVLHAESGHMPEFVERPADYWDAADLYERANGR
LFKEVEFALPVELTLDQQKALASEFAQHLTGAERLPYTLAIHAGGGENPHCHLMISERINDGIERPAAQW
FKRYNGKTPEKGGAQKTEALKPKAWLEQTREAWADHANRALERAGHDARIDHRTLEAQGIERLPGVHLGP
NVVEMEGRGIRTDRADVALNIDTANAQIIDLQEYREAIDHERNRQSEEIQRHQRVSGADRTAGPEHGDTG
RRSPAGHEPDPAGQRGAGGGVAESPAPDRGGMGGAGQRVAGGSRRGEQRRAERPERVAGVALEAMANRDA
GFHDAYGGAADRIVALARPDATDNRGRLDLAALGGPMKNDRTLQAIGRQLKAMGCERFDIGVRDATTGQM
MNREWSAAEVLQNTPWLKRMNAQGNDVYIRPAEQERHGLVLVDDLSEFDLDDMKAEGREPALVVETSPKN
YQAWVKVADAAGGELRGQIARTLASEYDADPASADSRHYGRLAGFTNRKDKHTTRAGYQPWVLLRESKGK
TATAGPALVQQAGQQIEQAQRQQEKARRLASLELPERQLSRHRRTALDEYRSEMAGLVKRFGDDLSKCDF
IAAQKLASRGRSAEEIGKAMAEASPALAERKPGHEADYIERTVSKVMGLPSVQLARAELARAPAPRQRGM
DRGGPDFSM

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
PDB 2NS6
AlphaFold DB P07112

  Reference


[1] de la Cruz F et al. (2010) Conjugative DNA metabolism in Gram-negative bacteria. FEMS Microbiol Rev. 34(1):18-40. [PMID:19919603]
[2] Meyer R (2009) The R1162 mob proteins can promote conjugative transfer from cryptic origins in the bacterial chromosome. J Bacteriol. 191(5):1574-80. [PMID:19074386]
[3] Parker C et al. (2007) The R1162 relaxase/primase contains two, type IV transport signals that require the small plasmid protein MobB. Mol Microbiol. 66(1):252-61. [PMID:17880426]
[4] Jandle S et al. (2006) Stringent and relaxed recognition of oriT by related systems for plasmid mobilization: implications for horizontal gene transfer. J Bacteriol. 188(2):499-506. [PMID:16385040]
[5] Zhang S et al. (1997) The relaxosome protein MobC promotes conjugal plasmid mobilization by extending DNA strand separation to the nick site at the origin of transfer. Mol Microbiol. 25(3):509-16. [PMID:9302013]
[6] Brasch MA et al. (1986) Genetic organization of plasmid R1162 DNA involved in conjugative mobilization. J Bacteriol. 167(2):703-10. [PMID:3525520]


Auxiliary protein

ID   14 GenBank   _
Name   MobB_R1162 experimental UniProt ID   _
Length   _ a.a. PDB ID   _
Note   The relaxase MobA_R1162 contains two, auxiliary protein MobB_R1162-dependent type IV transport signals [PMID:17880426].

  Auxiliary protein sequence


Download         Length: _ a.a.        Molecular weight: Da        Isoelectric Point:


  Protein domains



No domain identified.



  Protein structure



No available structure.



  Reference


[1] de la Cruz F et al. (2010) Conjugative DNA metabolism in Gram-negative bacteria. FEMS Microbiol Rev. 34(1):18-40. [PMID:19919603]
[2] Parker C et al. (2007) The R1162 relaxase/primase contains two, type IV transport signals that require the small plasmid protein MobB. Mol Microbiol. 66(1):252-61. [PMID:17880426]
[3] Jandle S et al. (2006) Stringent and relaxed recognition of oriT by related systems for plasmid mobilization: implications for horizontal gene transfer. J Bacteriol. 188(2):499-506. [PMID:16385040]

ID   15 GenBank   _
Name   MobC_R1162 experimental UniProt ID   _
Length   _ a.a. PDB ID   _
Note   R1162 encodes two small proteins required for efficient transfer: MobB (MW 15,115) and MobC (MW 10,885).

  Auxiliary protein sequence


Download         Length: _ a.a.        Molecular weight: Da        Isoelectric Point:


  Protein domains



No domain identified.



  Protein structure



No available structure.



  Reference


[1] de la Cruz F et al. (2010) Conjugative DNA metabolism in Gram-negative bacteria. FEMS Microbiol Rev. 34(1):18-40. [PMID:19919603]
[2] Parker C et al. (2007) The R1162 relaxase/primase contains two, type IV transport signals that require the small plasmid protein MobB. Mol Microbiol. 66(1):252-61. [PMID:17880426]
[3] Jandle S et al. (2006) Stringent and relaxed recognition of oriT by related systems for plasmid mobilization: implications for horizontal gene transfer. J Bacteriol. 188(2):499-506. [PMID:16385040]
[4] Zhang S et al. (1997) The relaxosome protein MobC promotes conjugal plasmid mobilization by extending DNA strand separation to the nick site at the origin of transfer. Mol Microbiol. 25(3):509-16. [PMID:9302013]


Host bacterium

ID   8 GenBank   M13380
Plasmid name   R1162 Incompatibility group   IncQ1
Plasmid size   721 bp Coordinate of oriT [Strand]   111..270 [+]
Host baterium   Pseudomonas aeruginosa

Cargo genes

Drug resistance gene   resistance to sulfonamides and streptomycin
Virulence gene   _
Metal resistance gene   _
Degradation gene   _
Symbiosis gene   -
Anti-CRISPR   -