Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4422334..4422556 | Replicon | chromosome |
| Accession | NZ_CP010443 | ||
| Organism | Escherichia coli K-12 strain K-12 MG1655 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | SH04_RS21880 | Protein ID | WP_000141634.1 |
| Coordinates | 4422334..4422441 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4422490..4422556 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SH04_RS21860 | 4417731..4418747 | - | 1017 | WP_010723085.1 | IS5-like element IS5 family transposase | - |
| SH04_RS21865 | 4418812..4420383 | + | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
| SH04_RS21870 | 4420380..4420571 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| SH04_RS21875 | 4420568..4422247 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| SH04_RS21880 | 4422334..4422441 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| - | 4422490..4422556 | + | 67 | - | - | Antitoxin |
| SH04_RS21890 | 4422917..4424188 | + | 1272 | WP_001295225.1 | transporter | - |
| SH04_RS21895 | 4424218..4425222 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| SH04_RS21900 | 4425219..4426202 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| SH04_RS21905 | 4426213..4427115 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 4417731..4418711 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T52649 WP_000141634.1 NZ_CP010443:c4422441-4422334 [Escherichia coli K-12]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T52649 NZ_CP010443:c4422441-4422334 [Escherichia coli K-12]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT52649 NZ_CP010443:4422490-4422556 [Escherichia coli K-12]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|