Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 4475907..4476129 | Replicon | chromosome |
Accession | NZ_CP010442 | ||
Organism | Escherichia coli K-12 strain K-12 MG1655 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1E8T8 |
Locus tag | SH06_RS22200 | Protein ID | WP_000141634.1 |
Coordinates | 4475907..4476014 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 4476063..4476129 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SH06_RS22180 | 4471304..4472320 | - | 1017 | WP_010723085.1 | IS5-like element IS5 family transposase | - |
SH06_RS22185 | 4472385..4473956 | + | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
SH06_RS22190 | 4473953..4474144 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
SH06_RS22195 | 4474141..4475820 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
SH06_RS22200 | 4475907..4476014 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
- | 4476063..4476129 | + | 67 | - | - | Antitoxin |
SH06_RS22210 | 4476490..4477761 | + | 1272 | WP_001295225.1 | transporter | - |
SH06_RS22215 | 4477791..4478795 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
SH06_RS22220 | 4478792..4479775 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
SH06_RS22225 | 4479786..4480688 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 4471304..4472284 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T52608 WP_000141634.1 NZ_CP010442:c4476014-4475907 [Escherichia coli K-12]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T52608 NZ_CP010442:c4476014-4475907 [Escherichia coli K-12]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT52608 NZ_CP010442:4476063-4476129 [Escherichia coli K-12]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|