Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 4423109..4423331 | Replicon | chromosome |
Accession | NZ_CP010441 | ||
Organism | Escherichia coli K-12 strain K-12 MG1655 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1E8T8 |
Locus tag | SH03_RS21890 | Protein ID | WP_000141634.1 |
Coordinates | 4423109..4423216 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 4423265..4423331 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SH03_RS21870 | 4418506..4419522 | - | 1017 | WP_010723085.1 | IS5-like element IS5 family transposase | - |
SH03_RS21875 | 4419587..4421158 | + | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
SH03_RS21880 | 4421155..4421346 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
SH03_RS21885 | 4421343..4423022 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
SH03_RS21890 | 4423109..4423216 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
- | 4423265..4423331 | + | 67 | - | - | Antitoxin |
SH03_RS21900 | 4423692..4424963 | + | 1272 | WP_001295225.1 | transporter | - |
SH03_RS21905 | 4424993..4425997 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
SH03_RS21910 | 4425994..4426977 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
SH03_RS21915 | 4426988..4427890 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 4418506..4419486 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T52566 WP_000141634.1 NZ_CP010441:c4423216-4423109 [Escherichia coli K-12]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T52566 NZ_CP010441:c4423216-4423109 [Escherichia coli K-12]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT52566 NZ_CP010441:4423265-4423331 [Escherichia coli K-12]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|