294645

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3594019..3594605 Replicon chromosome
Accession NZ_OU015340
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00027944 isolate AUSMDU00027944

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag KKR00_RS18135 Protein ID WP_001521773.1
Coordinates 3594237..3594605 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag KKR00_RS18130 Protein ID WP_001520924.1
Coordinates 3594019..3594240 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KKR00_RS18105 (3589039) 3589039..3590148 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
KKR00_RS18110 (3590208) 3590208..3591134 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
KKR00_RS18115 (3591131) 3591131..3592408 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
KKR00_RS18120 (3592405) 3592405..3593172 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
KKR00_RS18125 (3593174) 3593174..3593887 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
KKR00_RS18130 (3594019) 3594019..3594240 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
KKR00_RS18135 (3594237) 3594237..3594605 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
KKR00_RS18140 (3594864) 3594864..3596180 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
KKR00_RS18145 (3596244) 3596244..3597131 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
KKR00_RS18150 (3597128) 3597128..3597973 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
KKR00_RS18155 (3597975) 3597975..3599045 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3591131..3599782 8651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T294645 WP_001521773.1 NZ_OU015340:3594237-3594605 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT294645 WP_001520924.1 NZ_OU015340:3594019-3594240 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References