Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4281851..4282665 | Replicon | chromosome |
Accession | NZ_OU015323 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00004549 isolate AUSMDU00004549 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | KKQ99_RS21535 | Protein ID | WP_000971655.1 |
Coordinates | 4281851..4282378 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | KKQ99_RS21540 | Protein ID | WP_000855692.1 |
Coordinates | 4282375..4282665 (-) | Length | 97 a.a. |
Genomic Context
Location: 4279877..4280398 (522 bp)
Type: Others
Protein ID: WP_000858988.1
Type: Others
Protein ID: WP_000858988.1
Location: 4281573..4281778 (206 bp)
Type: Others
Protein ID: Protein_4225
Type: Others
Protein ID: Protein_4225
Location: 4283354..4283680 (327 bp)
Type: Others
Protein ID: WP_000393302.1
Type: Others
Protein ID: WP_000393302.1
Location: 4286065..4286715 (651 bp)
Type: Others
Protein ID: WP_001674874.1
Type: Others
Protein ID: WP_001674874.1
Location: 4277151..4279718 (2568 bp)
Type: Others
Protein ID: WP_001005807.1
Type: Others
Protein ID: WP_001005807.1
Location: 4280570..4281226 (657 bp)
Type: Others
Protein ID: WP_000420452.1
Type: Others
Protein ID: WP_000420452.1
Location: 4281851..4282378 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1
Type: Toxin
Protein ID: WP_000971655.1
Location: 4282375..4282665 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1
Type: Antitoxin
Protein ID: WP_000855692.1
Location: 4282935..4283113 (179 bp)
Type: Others
Protein ID: Protein_4228
Type: Others
Protein ID: Protein_4228
Location: 4283953..4284300 (348 bp)
Type: Others
Protein ID: WP_001669174.1
Type: Others
Protein ID: WP_001669174.1
Location: 4284285..4284734 (450 bp)
Type: Others
Protein ID: WP_000381610.1
Type: Others
Protein ID: WP_000381610.1
Location: 4285165..4285608 (444 bp)
Type: Others
Protein ID: WP_000715092.1
Type: Others
Protein ID: WP_000715092.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KKQ99_RS21515 (4277151) | 4277151..4279718 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
KKQ99_RS21520 (4279877) | 4279877..4280398 | + | 522 | WP_000858988.1 | hypothetical protein | - |
KKQ99_RS21525 (4280570) | 4280570..4281226 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
KKQ99_RS21530 (4281573) | 4281573..4281778 | + | 206 | Protein_4225 | IS5/IS1182 family transposase | - |
KKQ99_RS21535 (4281851) | 4281851..4282378 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
KKQ99_RS21540 (4282375) | 4282375..4282665 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
KKQ99_RS21545 (4282935) | 4282935..4283113 | - | 179 | Protein_4228 | IS3 family transposase | - |
KKQ99_RS21550 (4283354) | 4283354..4283680 | + | 327 | WP_000393302.1 | hypothetical protein | - |
KKQ99_RS21555 (4283953) | 4283953..4284300 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
KKQ99_RS21560 (4284285) | 4284285..4284734 | - | 450 | WP_000381610.1 | membrane protein | - |
KKQ99_RS21565 (4285165) | 4285165..4285608 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
KKQ99_RS21570 (4286065) | 4286065..4286715 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | invH / invF / invG / invE / invA / invB / invC/sctN / invI / invJ / spaO/sctQ / spaP / spaQ / spaR / spaS / sicA / sipB/sspB / sipC/sspC / sipC/sspC / sipD / sipA/sspA / sicP / sptP / prgH / prgI / prgJ / prgK / orgA/sctK / orgB/SctL / orgC / avrA / avrA | 4281602..4323750 | 42148 | |
flank | IS/Tn | - | - | 4281602..4281778 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T294628 WP_000971655.1 NZ_OU015323:c4282378-4281851 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10678.57 Da Isoelectric Point: 8.5779
>AT294628 WP_000855692.1 NZ_OU015323:c4282665-4282375 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp