Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3569875..3570461 Replicon chromosome
Accession NZ_OU015323
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00004549 isolate AUSMDU00004549

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag KKQ99_RS18020 Protein ID WP_001521773.1
Coordinates 3570093..3570461 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag KKQ99_RS18015 Protein ID WP_001520924.1
Coordinates 3569875..3570096 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KKQ99_RS17990 (3564895) 3564895..3566004 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
KKQ99_RS17995 (3566064) 3566064..3566990 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
KKQ99_RS18000 (3566987) 3566987..3568264 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
KKQ99_RS18005 (3568261) 3568261..3569028 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
KKQ99_RS18010 (3569030) 3569030..3569743 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
KKQ99_RS18015 (3569875) 3569875..3570096 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
KKQ99_RS18020 (3570093) 3570093..3570461 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
KKQ99_RS18025 (3570720) 3570720..3572036 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
KKQ99_RS18030 (3572100) 3572100..3572987 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
KKQ99_RS18035 (3572984) 3572984..3573829 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
KKQ99_RS18040 (3573831) 3573831..3574901 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3566987..3575638 8651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T294624 WP_001521773.1 NZ_OU015323:3570093-3570461 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT294624 WP_001520924.1 NZ_OU015323:3569875-3570096 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References