Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 1011118..1012436 | Replicon | chromosome |
Accession | NZ_LT903847 | ||
Organism | Escherichia coli O127:H6 isolate EPEC1 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | B7UL96 |
Locus tag | BQ9550_RS05100 | Protein ID | WP_001262465.1 |
Coordinates | 1011429..1012436 (+) | Length | 336 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | B7UL97 |
Locus tag | BQ9550_RS05095 | Protein ID | WP_001346664.1 |
Coordinates | 1011118..1011429 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BQ9550_RS05070 | 1006650..1007669 | + | 1020 | WP_000938855.1 | dipeptide ABC transporter permease DppB | - |
BQ9550_RS05075 | 1007679..1008581 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
BQ9550_RS05080 | 1008592..1009575 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
BQ9550_RS05085 | 1009572..1010585 | + | 1014 | WP_000103582.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
BQ9550_RS05090 | 1010810..1011133 | + | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
BQ9550_RS05095 | 1011118..1011429 | + | 312 | WP_001346664.1 | HipA N-terminal domain-containing protein | Antitoxin |
BQ9550_RS05100 | 1011429..1012436 | + | 1008 | WP_001262465.1 | HipA domain-containing protein | Toxin |
BQ9550_RS05105 | 1012453..1013724 | - | 1272 | WP_001339917.1 | amino acid permease | - |
- | 1014086..1014151 | - | 66 | NuclAT_19 | - | - |
- | 1014086..1014151 | - | 66 | NuclAT_19 | - | - |
- | 1014086..1014151 | - | 66 | NuclAT_19 | - | - |
- | 1014086..1014151 | - | 66 | NuclAT_19 | - | - |
- | 1014086..1014151 | - | 66 | NuclAT_25 | - | - |
- | 1014086..1014151 | - | 66 | NuclAT_25 | - | - |
- | 1014086..1014151 | - | 66 | NuclAT_25 | - | - |
- | 1014086..1014151 | - | 66 | NuclAT_25 | - | - |
BQ9550_RS25465 | 1014200..1014307 | + | 108 | WP_000170747.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 1014569..1014634 | - | 66 | NuclAT_18 | - | - |
- | 1014569..1014634 | - | 66 | NuclAT_18 | - | - |
- | 1014569..1014634 | - | 66 | NuclAT_18 | - | - |
- | 1014569..1014634 | - | 66 | NuclAT_18 | - | - |
- | 1014569..1014634 | - | 66 | NuclAT_24 | - | - |
- | 1014569..1014634 | - | 66 | NuclAT_24 | - | - |
- | 1014569..1014634 | - | 66 | NuclAT_24 | - | - |
- | 1014569..1014634 | - | 66 | NuclAT_24 | - | - |
BQ9550_RS05130 | 1014683..1014790 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
BQ9550_RS05140 | 1015014..1015472 | + | 459 | WP_000526113.1 | IS200/IS605-like element IS200C family transposase | - |
BQ9550_RS05145 | 1015587..1017266 | - | 1680 | WP_000191555.1 | cellulose biosynthesis protein BcsG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 1015014..1015472 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 336 a.a. Molecular weight: 38329.55 Da Isoelectric Point: 5.4135
>T293640 WP_001262465.1 NZ_LT903847:1011429-1012436 [Escherichia coli O127:H6]
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLNPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQITD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFYSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLNPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQITD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFYSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
Download Length: 1008 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|