Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
| Location | 3832905..3834223 | Replicon | chromosome |
| Accession | NZ_LT827011 | ||
| Organism | Escherichia coli O127:H6 isolate EPEC E2348/69 variety | ||
Toxin (Protein)
| Gene name | HipT | Uniprot ID | B7UL96 |
| Locus tag | BQ9544_RS20510 | Protein ID | WP_001262465.1 |
| Coordinates | 3832905..3833912 (-) | Length | 336 a.a. |
Antitoxin (Protein)
| Gene name | HipS | Uniprot ID | B7UL97 |
| Locus tag | BQ9544_RS20515 | Protein ID | WP_001346664.1 |
| Coordinates | 3833912..3834223 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ9544_RS20465 | 3828075..3829754 | + | 1680 | WP_000191555.1 | cellulose biosynthesis protein BcsG | - |
| BQ9544_RS20470 | 3829869..3830327 | - | 459 | WP_000526113.1 | IS200/IS605-like element IS200C family transposase | - |
| BQ9544_RS20480 | 3830551..3830658 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 3830707..3830772 | + | 66 | NuclAT_18 | - | - |
| - | 3830707..3830772 | + | 66 | NuclAT_18 | - | - |
| - | 3830707..3830772 | + | 66 | NuclAT_18 | - | - |
| - | 3830707..3830772 | + | 66 | NuclAT_18 | - | - |
| - | 3830707..3830772 | + | 66 | NuclAT_24 | - | - |
| - | 3830707..3830772 | + | 66 | NuclAT_24 | - | - |
| - | 3830707..3830772 | + | 66 | NuclAT_24 | - | - |
| - | 3830707..3830772 | + | 66 | NuclAT_24 | - | - |
| BQ9544_RS25850 | 3831034..3831141 | - | 108 | WP_000170747.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 3831190..3831255 | + | 66 | NuclAT_19 | - | - |
| - | 3831190..3831255 | + | 66 | NuclAT_19 | - | - |
| - | 3831190..3831255 | + | 66 | NuclAT_19 | - | - |
| - | 3831190..3831255 | + | 66 | NuclAT_19 | - | - |
| - | 3831190..3831255 | + | 66 | NuclAT_25 | - | - |
| - | 3831190..3831255 | + | 66 | NuclAT_25 | - | - |
| - | 3831190..3831255 | + | 66 | NuclAT_25 | - | - |
| - | 3831190..3831255 | + | 66 | NuclAT_25 | - | - |
| BQ9544_RS20505 | 3831617..3832888 | + | 1272 | WP_001339917.1 | amino acid permease | - |
| BQ9544_RS20510 | 3832905..3833912 | - | 1008 | WP_001262465.1 | HipA domain-containing protein | Toxin |
| BQ9544_RS20515 | 3833912..3834223 | - | 312 | WP_001346664.1 | HipA N-terminal domain-containing protein | Antitoxin |
| BQ9544_RS20520 | 3834208..3834531 | - | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
| BQ9544_RS20525 | 3834756..3835769 | - | 1014 | WP_000103582.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| BQ9544_RS20530 | 3835766..3836749 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| BQ9544_RS20535 | 3836760..3837662 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| BQ9544_RS20540 | 3837672..3838691 | - | 1020 | WP_000938855.1 | dipeptide ABC transporter permease DppB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 3829869..3830327 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 336 a.a. Molecular weight: 38329.55 Da Isoelectric Point: 5.4135
>T293505 WP_001262465.1 NZ_LT827011:c3833912-3832905 [Escherichia coli O127:H6]
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLNPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQITD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFYSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLNPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQITD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFYSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
Download Length: 1008 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|