Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 2729496..2730163 | Replicon | chromosome |
Accession | NZ_LM993812 | ||
Organism | Escherichia coli strain K-12 substr. HMS174 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | ECHMS174_RS13520 | Protein ID | WP_001094400.1 |
Coordinates | 2729834..2730163 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | ECHMS174_RS13515 | Protein ID | WP_000072690.1 |
Coordinates | 2729496..2729813 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECHMS174_RS13495 | 2724548..2725557 | - | 1010 | Protein_2579 | arsenic transporter | - |
ECHMS174_RS13500 | 2725699..2727402 | + | 1704 | WP_000896263.1 | hypothetical protein | - |
ECHMS174_RS23890 | 2727974..2728197 | + | 224 | Protein_2581 | DUF905 family protein | - |
ECHMS174_RS13505 | 2728300..2728758 | + | 459 | WP_000211841.1 | antirestriction protein | - |
ECHMS174_RS13510 | 2728767..2729249 | + | 483 | WP_001407480.1 | RadC family protein | - |
ECHMS174_RS23895 | 2729258..2729458 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
ECHMS174_RS13515 | 2729496..2729813 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
ECHMS174_RS13520 | 2729834..2730163 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
ECHMS174_RS22835 | 2730527..2735107 | - | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2708540..2740619 | 32079 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T285407 WP_001094400.1 NZ_LM993812:2729834-2730163 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P52141 |