Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 308387..308973 Replicon chromosome
Accession NZ_CP126325
Organism Salmonella enterica subsp. enterica strain HL21

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag QN088_RS01415 Protein ID WP_000174963.1
Coordinates 308605..308973 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag QN088_RS01410 Protein ID WP_001520924.1
Coordinates 308387..308608 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QN088_RS01385 (303408) 303408..304517 + 1110 WP_000822968.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
QN088_RS01390 (304577) 304577..305503 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QN088_RS01395 (305500) 305500..306777 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
QN088_RS01400 (306774) 306774..307541 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QN088_RS01405 (307543) 307543..308256 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QN088_RS01410 (308387) 308387..308608 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QN088_RS01415 (308605) 308605..308973 + 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QN088_RS01420 (309232) 309232..310548 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QN088_RS01425 (310653) 310653..311540 + 888 WP_284546149.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QN088_RS01430 (311537) 311537..312382 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QN088_RS01435 (312384) 312384..313454 + 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 305500..314191 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T282766 WP_000174963.1 NZ_CP126325:308605-308973 [Salmonella enterica subsp. enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT282766 WP_001520924.1 NZ_CP126325:308387-308608 [Salmonella enterica subsp. enterica]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References