Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3824047..3824861 | Replicon | chromosome |
Accession | NZ_CP126323 | ||
Organism | Salmonella enterica subsp. enterica strain CY16 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | B5RDM7 |
Locus tag | QN087_RS18530 | Protein ID | WP_000971654.1 |
Coordinates | 3824334..3824861 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | QN087_RS18525 | Protein ID | WP_000855694.1 |
Coordinates | 3824047..3824337 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QN087_RS18505 (3819950) | 3819950..3821638 | - | 1689 | WP_000848115.1 | type III secretion system outer membrane ring protein InvG | - |
QN087_RS18510 (3821635) | 3821635..3822285 | - | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
QN087_RS18515 (3822741) | 3822741..3823184 | + | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
QN087_RS18520 (3823588) | 3823588..3823777 | + | 190 | Protein_3628 | IS3 family transposase | - |
QN087_RS18525 (3824047) | 3824047..3824337 | + | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
QN087_RS18530 (3824334) | 3824334..3824861 | + | 528 | WP_000971654.1 | GNAT family N-acetyltransferase | Toxin |
QN087_RS18535 (3824934) | 3824934..3825139 | - | 206 | Protein_3631 | IS5/IS1182 family transposase | - |
QN087_RS18540 (3825498) | 3825498..3826154 | + | 657 | WP_000420455.1 | protein-serine/threonine phosphatase | - |
QN087_RS18545 (3826399) | 3826399..3826893 | - | 495 | WP_000424949.1 | hypothetical protein | - |
QN087_RS18550 (3826920) | 3826920..3827588 | - | 669 | WP_000445914.1 | hypothetical protein | - |
QN087_RS18555 (3828174) | 3828174..3828572 | - | 399 | Protein_3635 | cytoplasmic protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 3824934..3825110 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19041.85 Da Isoelectric Point: 9.6420
>T282759 WP_000971654.1 NZ_CP126323:3824334-3824861 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQACDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQACDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y9PNF0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |