Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2610708..2611522 | Replicon | chromosome |
Accession | NZ_CP126166 | ||
Organism | Salmonella enterica subsp. enterica strain CRSE-01 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | NED09_RS12495 | Protein ID | WP_000971655.1 |
Coordinates | 2610708..2611235 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | NED09_RS12500 | Protein ID | WP_000855694.1 |
Coordinates | 2611232..2611522 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NED09_RS12470 (2606997) | 2606997..2607395 | + | 399 | Protein_2414 | cytoplasmic protein | - |
NED09_RS12475 (2607981) | 2607981..2608649 | + | 669 | WP_000445914.1 | hypothetical protein | - |
NED09_RS12480 (2608676) | 2608676..2609170 | + | 495 | WP_000424949.1 | hypothetical protein | - |
NED09_RS12485 (2609415) | 2609415..2610071 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
NED09_RS12490 (2610430) | 2610430..2610635 | + | 206 | Protein_2418 | IS5/IS1182 family transposase | - |
NED09_RS12495 (2610708) | 2610708..2611235 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
NED09_RS12500 (2611232) | 2611232..2611522 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
NED09_RS12505 (2611792) | 2611792..2611981 | - | 190 | Protein_2421 | IS3 family transposase | - |
NED09_RS12510 (2612385) | 2612385..2612828 | - | 444 | WP_000715097.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NED09_RS12515 (2613284) | 2613284..2613934 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
NED09_RS12520 (2613931) | 2613931..2615619 | + | 1689 | WP_000848113.1 | type III secretion system outer membrane ring protein InvG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2610459..2610635 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T282714 WP_000971655.1 NZ_CP126166:c2611235-2610708 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |