Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 316493..317079 Replicon chromosome
Accession NZ_CP126138
Organism Salmonella enterica subsp. enterica serovar Kottbus strain DSK01

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag QNM33_RS01450 Protein ID WP_001521773.1
Coordinates 316711..317079 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag QNM33_RS01445 Protein ID WP_001520924.1
Coordinates 316493..316714 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNM33_RS01420 (311513) 311513..312622 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
QNM33_RS01425 (312682) 312682..313608 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QNM33_RS01430 (313605) 313605..314882 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
QNM33_RS01435 (314879) 314879..315646 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QNM33_RS01440 (315648) 315648..316361 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QNM33_RS01445 (316493) 316493..316714 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QNM33_RS01450 (316711) 316711..317079 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QNM33_RS01455 (317338) 317338..318654 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QNM33_RS01460 (318718) 318718..319605 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QNM33_RS01465 (319602) 319602..320447 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QNM33_RS01470 (320449) 320449..321519 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 313605..322256 8651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T282653 WP_001521773.1 NZ_CP126138:316711-317079 [Salmonella enterica subsp. enterica serovar Kottbus]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT282653 WP_001520924.1 NZ_CP126138:316493-316714 [Salmonella enterica subsp. enterica serovar Kottbus]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References