Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 316465..317051 Replicon chromosome
Accession NZ_CP122457
Organism Salmonella enterica subsp. enterica strain TZ282

Toxin (Protein)


Gene name doc Uniprot ID A0A0R9MYB2
Locus tag QCX26_RS01440 Protein ID WP_000174966.1
Coordinates 316683..317051 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0R9PI96
Locus tag QCX26_RS01435 Protein ID WP_001535398.1
Coordinates 316465..316686 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCX26_RS01410 (311485) 311485..312594 + 1110 WP_000822983.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
QCX26_RS01415 (312654) 312654..313580 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QCX26_RS01420 (313577) 313577..314854 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
QCX26_RS01425 (314851) 314851..315618 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QCX26_RS01430 (315620) 315620..316333 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QCX26_RS01435 (316465) 316465..316686 + 222 WP_001535398.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QCX26_RS01440 (316683) 316683..317051 + 369 WP_000174966.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QCX26_RS01445 (317310) 317310..318626 + 1317 WP_000624749.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QCX26_RS01450 (318731) 318731..319618 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QCX26_RS01455 (319615) 319615..320460 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QCX26_RS01460 (320463) 320463..321533 + 1071 WP_079983930.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 313577..322270 8693


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13629.91 Da        Isoelectric Point: 6.4657

>T276944 WP_000174966.1 NZ_CP122457:316683-317051 [Salmonella enterica subsp. enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.23 Da        Isoelectric Point: 6.4643

>AT276944 WP_001535398.1 NZ_CP122457:316465-316686 [Salmonella enterica subsp. enterica]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9MYB2

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PI96

References