Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 316465..317051 | Replicon | chromosome |
Accession | NZ_CP122457 | ||
Organism | Salmonella enterica subsp. enterica strain TZ282 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A0R9MYB2 |
Locus tag | QCX26_RS01440 | Protein ID | WP_000174966.1 |
Coordinates | 316683..317051 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A0R9PI96 |
Locus tag | QCX26_RS01435 | Protein ID | WP_001535398.1 |
Coordinates | 316465..316686 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCX26_RS01410 (311485) | 311485..312594 | + | 1110 | WP_000822983.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
QCX26_RS01415 (312654) | 312654..313580 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
QCX26_RS01420 (313577) | 313577..314854 | + | 1278 | WP_000803766.1 | branched chain amino acid ABC transporter permease LivM | - |
QCX26_RS01425 (314851) | 314851..315618 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
QCX26_RS01430 (315620) | 315620..316333 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
QCX26_RS01435 (316465) | 316465..316686 | + | 222 | WP_001535398.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QCX26_RS01440 (316683) | 316683..317051 | + | 369 | WP_000174966.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QCX26_RS01445 (317310) | 317310..318626 | + | 1317 | WP_000624749.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
QCX26_RS01450 (318731) | 318731..319618 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
QCX26_RS01455 (319615) | 319615..320460 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
QCX26_RS01460 (320463) | 320463..321533 | + | 1071 | WP_079983930.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 313577..322270 | 8693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13629.91 Da Isoelectric Point: 6.4657
>T276944 WP_000174966.1 NZ_CP122457:316683-317051 [Salmonella enterica subsp. enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9MYB2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PI96 |