Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 137830..138497 | Replicon | chromosome |
| Accession | NZ_CP122318 | ||
| Organism | Escherichia coli strain HT873X1 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | Q46953 |
| Locus tag | QCG45_RS00675 | Protein ID | WP_001094400.1 |
| Coordinates | 137830..138159 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | P52141 |
| Locus tag | QCG45_RS00680 | Protein ID | WP_000072690.1 |
| Coordinates | 138180..138497 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCG45_RS00670 (132886) | 132886..137466 | + | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
| QCG45_RS00675 (137830) | 137830..138159 | - | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
| QCG45_RS00680 (138180) | 138180..138497 | - | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QCG45_RS00685 (138535) | 138535..138735 | - | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
| QCG45_RS00690 (138744) | 138744..139226 | - | 483 | WP_001407480.1 | RadC family protein | - |
| QCG45_RS00695 (139235) | 139235..139693 | - | 459 | WP_000211841.1 | antirestriction protein | - |
| QCG45_RS00700 (139796) | 139796..139980 | - | 185 | Protein_133 | DUF905 family protein | - |
| QCG45_RS00705 (140591) | 140591..142294 | - | 1704 | WP_000896263.1 | protein YfjW | - |
| QCG45_RS00710 (142436) | 142436..143445 | + | 1010 | Protein_135 | arsenic transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 128178..160058 | 31880 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T276721 WP_001094400.1 NZ_CP122318:c138159-137830 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A373F4I3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2EA9 | |
| PDB | 2JN7 | |
| AlphaFold DB | P52141 |