Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 988505..989319 | Replicon | chromosome |
| Accession | NZ_CP122301 | ||
| Organism | Salmonella enterica strain 27A | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | Q57KM2 |
| Locus tag | P8R57_RS04715 | Protein ID | WP_000971655.1 |
| Coordinates | 988505..989032 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | P8R57_RS04720 | Protein ID | WP_000855694.1 |
| Coordinates | 989029..989319 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8R57_RS04690 (984794) | 984794..985192 | + | 399 | Protein_918 | cytoplasmic protein | - |
| P8R57_RS04695 (985778) | 985778..986446 | + | 669 | WP_000445914.1 | hypothetical protein | - |
| P8R57_RS04700 (986473) | 986473..986967 | + | 495 | WP_000424949.1 | hypothetical protein | - |
| P8R57_RS04705 (987212) | 987212..987868 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| P8R57_RS04710 (988227) | 988227..988432 | + | 206 | Protein_922 | IS5/IS1182 family transposase | - |
| P8R57_RS04715 (988505) | 988505..989032 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
| P8R57_RS04720 (989029) | 989029..989319 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| P8R57_RS04725 (989589) | 989589..989778 | - | 190 | Protein_925 | IS3 family transposase | - |
| P8R57_RS04730 (990182) | 990182..990625 | - | 444 | WP_000715097.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| P8R57_RS04735 (991081) | 991081..991731 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
| P8R57_RS04740 (991728) | 991728..993416 | + | 1689 | WP_000848113.1 | type III secretion system outer membrane ring protein InvG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 988256..988432 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T276607 WP_000971655.1 NZ_CP122301:c989032-988505 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6G96 | |
| PDB | 7AK9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V8SJE7 |