Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 669223..669809 Replicon chromosome
Accession NZ_CP121298
Organism Salmonella enterica subsp. enterica strain KKP 3080

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag P1839_RS03155 Protein ID WP_001521773.1
Coordinates 669441..669809 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag P1839_RS03150 Protein ID WP_001520924.1
Coordinates 669223..669444 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1839_RS03125 (664244) 664244..665353 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
P1839_RS03130 (665413) 665413..666339 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P1839_RS03135 (666336) 666336..667613 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
P1839_RS03140 (667610) 667610..668377 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P1839_RS03145 (668379) 668379..669092 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P1839_RS03150 (669223) 669223..669444 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P1839_RS03155 (669441) 669441..669809 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P1839_RS03160 (670068) 670068..671384 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P1839_RS03165 (671448) 671448..672335 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P1839_RS03170 (672332) 672332..673177 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P1839_RS03175 (673179) 673179..674249 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 666336..674986 8650


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T276253 WP_001521773.1 NZ_CP121298:669441-669809 [Salmonella enterica subsp. enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT276253 WP_001520924.1 NZ_CP121298:669223-669444 [Salmonella enterica subsp. enterica]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References