Detailed information of TA system TA275397

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 988504..989318
• Replicon: chromosome
• Accession: NZ_CP120837
• Organism: Salmonella enterica subsp. enterica strain 21A

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: P4B21_RS04715
• Protein ID: WP_000971655.1
• Coordinates: 988504..989031 (-)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: M7S6I2
• Locus tag: P4B21_RS04720
• Protein ID: WP_000855694.1
• Coordinates: 989028..989318 (-)
• Length: 97 a.a.

Genomic Context

Location: 984793..985191 (399 bp)
Type: Others
Protein ID: Protein_918

Location: 985777..986445 (669 bp)
Type: Others
Protein ID: WP_000445914.1

Location: 986472..986966 (495 bp)
Type: Others
Protein ID: WP_000424949.1

Location: 988226..988431 (206 bp)
Type: Others
Protein ID: Protein_922

Location: 991080..991730 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 991727..993415 (1689 bp)
Type: Others
Protein ID: WP_000848113.1

Location: 987211..987867 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 988504..989031 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 989028..989318 (291 bp)
Type: Antitoxin
Protein ID: WP_000855694.1

Location: 989588..989777 (190 bp)
Type: Others
Protein ID: Protein_925

Location: 990181..990624 (444 bp)
Type: Others
Protein ID: WP_000715097.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P4B21_RS04690 (984793)	984793..985191	+	399	Protein_918	cytoplasmic protein	-
P4B21_RS04695 (985777)	985777..986445	+	669	WP_000445914.1	hypothetical protein	-
P4B21_RS04700 (986472)	986472..986966	+	495	WP_000424949.1	hypothetical protein	-
P4B21_RS04705 (987211)	987211..987867	-	657	WP_000420452.1	protein-serine/threonine phosphatase	-
P4B21_RS04710 (988226)	988226..988431	+	206	Protein_922	IS5/IS1182 family transposase	-
P4B21_RS04715 (988504)	988504..989031	-	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
P4B21_RS04720 (989028)	989028..989318	-	291	WP_000855694.1	DUF1778 domain-containing protein	Antitoxin
P4B21_RS04725 (989588)	989588..989777	-	190	Protein_925	IS3 family transposase	-
P4B21_RS04730 (990181)	990181..990624	-	444	WP_000715097.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
P4B21_RS04735 (991080)	991080..991730	+	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-
P4B21_RS04740 (991727)	991727..993415	+	1689	WP_000848113.1	type III secretion system outer membrane ring protein InvG	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0.007 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0.007 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0.007	flank	IS/Tn	-	-	988255..988431	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T275397 WP_000971655.1 NZ_CP120837:c989031-988504 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10664.50 Da
• Isoelectric Point: 6.3133

>AT275397 WP_000855694.1 NZ_CP120837:c989318-989028 [Salmonella enterica subsp. enterica]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• AlphaFold DB: A0A3V8SJE7