Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 311661..312247 | Replicon | chromosome |
Accession | NZ_CP120347 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_2_2021 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A0R9MYB2 |
Locus tag | P1828_RS01420 | Protein ID | WP_000174966.1 |
Coordinates | 311879..312247 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A0R9PI96 |
Locus tag | P1828_RS01415 | Protein ID | WP_001535398.1 |
Coordinates | 311661..311882 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1828_RS01390 (306681) | 306681..307790 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
P1828_RS01395 (307850) | 307850..308776 | + | 927 | WP_000003005.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
P1828_RS01400 (308773) | 308773..310050 | + | 1278 | WP_000803766.1 | branched chain amino acid ABC transporter permease LivM | - |
P1828_RS01405 (310047) | 310047..310814 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
P1828_RS01410 (310816) | 310816..311529 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
P1828_RS01415 (311661) | 311661..311882 | + | 222 | WP_001535398.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P1828_RS01420 (311879) | 311879..312247 | + | 369 | WP_000174966.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
P1828_RS01425 (312506) | 312506..313822 | + | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
P1828_RS01430 (313927) | 313927..314814 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
P1828_RS01435 (314811) | 314811..315656 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
P1828_RS01440 (315658) | 315658..316728 | + | 1071 | WP_000907842.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 308773..317465 | 8692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13629.91 Da Isoelectric Point: 6.4657
>T274851 WP_000174966.1 NZ_CP120347:311879-312247 [Salmonella enterica subsp. enterica serovar Muenchen]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9MYB2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PI96 |