Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 311661..312247 Replicon chromosome
Accession NZ_CP120337
Organism Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_6_2021

Toxin (Protein)


Gene name doc Uniprot ID A0A0R9MYB2
Locus tag P1833_RS01425 Protein ID WP_000174966.1
Coordinates 311879..312247 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0R9PI96
Locus tag P1833_RS01420 Protein ID WP_001535398.1
Coordinates 311661..311882 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1833_RS01395 (306681) 306681..307790 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
P1833_RS01400 (307850) 307850..308776 + 927 WP_000003005.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P1833_RS01405 (308773) 308773..310050 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
P1833_RS01410 (310047) 310047..310814 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P1833_RS01415 (310816) 310816..311529 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P1833_RS01420 (311661) 311661..311882 + 222 WP_001535398.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P1833_RS01425 (311879) 311879..312247 + 369 WP_000174966.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P1833_RS01430 (312506) 312506..313822 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P1833_RS01435 (313927) 313927..314814 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P1833_RS01440 (314811) 314811..315656 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P1833_RS01445 (315658) 315658..316728 + 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 308773..317465 8692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13629.91 Da        Isoelectric Point: 6.4657

>T274767 WP_000174966.1 NZ_CP120337:311879-312247 [Salmonella enterica subsp. enterica serovar Muenchen]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.23 Da        Isoelectric Point: 6.4643

>AT274767 WP_001535398.1 NZ_CP120337:311661-311882 [Salmonella enterica subsp. enterica serovar Muenchen]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9MYB2

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PI96

References