Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 311662..312248 | Replicon | chromosome |
Accession | NZ_CP120325 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenchen strain PS_Mu_11_2021 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A0R9MYB2 |
Locus tag | P1704_RS01420 | Protein ID | WP_000174966.1 |
Coordinates | 311880..312248 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A0R9PI96 |
Locus tag | P1704_RS01415 | Protein ID | WP_001535398.1 |
Coordinates | 311662..311883 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1704_RS01390 (306682) | 306682..307791 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
P1704_RS01395 (307851) | 307851..308777 | + | 927 | WP_000003005.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
P1704_RS01400 (308774) | 308774..310051 | + | 1278 | WP_000803766.1 | branched chain amino acid ABC transporter permease LivM | - |
P1704_RS01405 (310048) | 310048..310815 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
P1704_RS01410 (310817) | 310817..311530 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
P1704_RS01415 (311662) | 311662..311883 | + | 222 | WP_001535398.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P1704_RS01420 (311880) | 311880..312248 | + | 369 | WP_000174966.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
P1704_RS01425 (312507) | 312507..313823 | + | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
P1704_RS01430 (313928) | 313928..314815 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
P1704_RS01435 (314812) | 314812..315657 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
P1704_RS01440 (315659) | 315659..316729 | + | 1071 | WP_000907842.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 308774..317466 | 8692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13629.91 Da Isoelectric Point: 6.4657
>T274664 WP_000174966.1 NZ_CP120325:311880-312248 [Salmonella enterica subsp. enterica serovar Muenchen]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9MYB2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PI96 |