Detailed information of TA system TA274656

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 3763444..3764258
• Replicon: chromosome
• Accession: NZ_CP120322
• Organism: Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_1_2022

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: P1705_RS18535
• Protein ID: WP_000971655.1
• Coordinates: 3763731..3764258 (+)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: M7S6I2
• Locus tag: P1705_RS18530
• Protein ID: WP_000855694.1
• Coordinates: 3763444..3763734 (+)
• Length: 97 a.a.

Genomic Context

Location: 3762138..3762581 (444 bp)
Type: Others
Protein ID: WP_000715096.1

Location: 3762985..3763174 (190 bp)
Type: Others
Protein ID: Protein_3582

Location: 3763444..3763734 (291 bp)
Type: Antitoxin
Protein ID: WP_000855694.1

Location: 3763731..3764258 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 3764895..3765551 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 3759347..3761035 (1689 bp)
Type: Others
Protein ID: WP_000848113.1

Location: 3761032..3761682 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 3764331..3764536 (206 bp)
Type: Others
Protein ID: Protein_3585

Location: 3765796..3766290 (495 bp)
Type: Others
Protein ID: WP_000424949.1

Location: 3766317..3766985 (669 bp)
Type: Others
Protein ID: WP_000445914.1

Location: 3767571..3767969 (399 bp)
Type: Others
Protein ID: Protein_3589

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P1705_RS18510 (3759347)	3759347..3761035	-	1689	WP_000848113.1	type III secretion system outer membrane ring protein InvG	-
P1705_RS18515 (3761032)	3761032..3761682	-	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-
P1705_RS18520 (3762138)	3762138..3762581	+	444	WP_000715096.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
P1705_RS18525 (3762985)	3762985..3763174	+	190	Protein_3582	IS3 family transposase	-
P1705_RS18530 (3763444)	3763444..3763734	+	291	WP_000855694.1	DUF1778 domain-containing protein	Antitoxin
P1705_RS18535 (3763731)	3763731..3764258	+	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
P1705_RS18540 (3764331)	3764331..3764536	-	206	Protein_3585	IS5/IS1182 family transposase	-
P1705_RS18545 (3764895)	3764895..3765551	+	657	WP_000420452.1	protein-serine/threonine phosphatase	-
P1705_RS18550 (3765796)	3765796..3766290	-	495	WP_000424949.1	hypothetical protein	-
P1705_RS18555 (3766317)	3766317..3766985	-	669	WP_000445914.1	hypothetical protein	-
P1705_RS18560 (3767571)	3767571..3767969	-	399	Protein_3589	cytoplasmic protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0.007 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0.007 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0.007	flank	IS/Tn	-	-	3764331..3764507	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T274656 WP_000971655.1 NZ_CP120322:3763731-3764258 [Salmonella enterica subsp. enterica serovar Enteritidis]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10664.50 Da
• Isoelectric Point: 6.3133

>AT274656 WP_000855694.1 NZ_CP120322:3763444-3763734 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• AlphaFold DB: A0A3V8SJE7