Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3763444..3764258 | Replicon | chromosome |
Accession | NZ_CP120322 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain PS_Ent_1_2022 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | P1705_RS18535 | Protein ID | WP_000971655.1 |
Coordinates | 3763731..3764258 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | P1705_RS18530 | Protein ID | WP_000855694.1 |
Coordinates | 3763444..3763734 (+) | Length | 97 a.a. |
Genomic Context
Location: 3762138..3762581 (444 bp)
Type: Others
Protein ID: WP_000715096.1
Type: Others
Protein ID: WP_000715096.1
Location: 3762985..3763174 (190 bp)
Type: Others
Protein ID: Protein_3582
Type: Others
Protein ID: Protein_3582
Location: 3763444..3763734 (291 bp)
Type: Antitoxin
Protein ID: WP_000855694.1
Type: Antitoxin
Protein ID: WP_000855694.1
Location: 3763731..3764258 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1
Type: Toxin
Protein ID: WP_000971655.1
Location: 3764895..3765551 (657 bp)
Type: Others
Protein ID: WP_000420452.1
Type: Others
Protein ID: WP_000420452.1
Location: 3759347..3761035 (1689 bp)
Type: Others
Protein ID: WP_000848113.1
Type: Others
Protein ID: WP_000848113.1
Location: 3761032..3761682 (651 bp)
Type: Others
Protein ID: WP_001674874.1
Type: Others
Protein ID: WP_001674874.1
Location: 3764331..3764536 (206 bp)
Type: Others
Protein ID: Protein_3585
Type: Others
Protein ID: Protein_3585
Location: 3765796..3766290 (495 bp)
Type: Others
Protein ID: WP_000424949.1
Type: Others
Protein ID: WP_000424949.1
Location: 3766317..3766985 (669 bp)
Type: Others
Protein ID: WP_000445914.1
Type: Others
Protein ID: WP_000445914.1
Location: 3767571..3767969 (399 bp)
Type: Others
Protein ID: Protein_3589
Type: Others
Protein ID: Protein_3589
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1705_RS18510 (3759347) | 3759347..3761035 | - | 1689 | WP_000848113.1 | type III secretion system outer membrane ring protein InvG | - |
P1705_RS18515 (3761032) | 3761032..3761682 | - | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
P1705_RS18520 (3762138) | 3762138..3762581 | + | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
P1705_RS18525 (3762985) | 3762985..3763174 | + | 190 | Protein_3582 | IS3 family transposase | - |
P1705_RS18530 (3763444) | 3763444..3763734 | + | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
P1705_RS18535 (3763731) | 3763731..3764258 | + | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
P1705_RS18540 (3764331) | 3764331..3764536 | - | 206 | Protein_3585 | IS5/IS1182 family transposase | - |
P1705_RS18545 (3764895) | 3764895..3765551 | + | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
P1705_RS18550 (3765796) | 3765796..3766290 | - | 495 | WP_000424949.1 | hypothetical protein | - |
P1705_RS18555 (3766317) | 3766317..3766985 | - | 669 | WP_000445914.1 | hypothetical protein | - |
P1705_RS18560 (3767571) | 3767571..3767969 | - | 399 | Protein_3589 | cytoplasmic protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 3764331..3764507 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T274656 WP_000971655.1 NZ_CP120322:3763731-3764258 [Salmonella enterica subsp. enterica serovar Enteritidis]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT274656 WP_000855694.1 NZ_CP120322:3763444-3763734 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp