Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 80861..81447 | Replicon | chromosome |
Accession | NZ_CP117976 | ||
Organism | Salmonella enterica strain B-4212 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | PT747_RS00320 | Protein ID | WP_137075820.1 |
Coordinates | 80861..81229 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | M7SDJ3 |
Locus tag | PT747_RS00325 | Protein ID | WP_001520924.1 |
Coordinates | 81226..81447 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PT747_RS00300 (76379) | 76379..77449 | - | 1071 | WP_011264401.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
PT747_RS00305 (77452) | 77452..78297 | - | 846 | WP_023235349.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
PT747_RS00310 (78294) | 78294..79181 | - | 888 | WP_000094074.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
PT747_RS00315 (79286) | 79286..80602 | - | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
PT747_RS00320 (80861) | 80861..81229 | - | 369 | WP_137075820.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PT747_RS00325 (81226) | 81226..81447 | - | 222 | WP_001520924.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PT747_RS00330 (81578) | 81578..82291 | - | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
PT747_RS00335 (82293) | 82293..83060 | - | 768 | WP_000082080.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
PT747_RS00340 (83057) | 83057..84334 | - | 1278 | WP_001541045.1 | branched chain amino acid ABC transporter permease LivM | - |
PT747_RS00345 (84331) | 84331..85257 | - | 927 | WP_000003005.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PT747_RS00350 (85317) | 85317..86420 | - | 1104 | WP_023235350.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 75642..84334 | 8692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13603.88 Da Isoelectric Point: 6.7252
>T272617 WP_137075820.1 NZ_CP117976:c81229-80861 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPSVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPSVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|