Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 80861..81447 Replicon chromosome
Accession NZ_CP117976
Organism Salmonella enterica strain B-4212

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag PT747_RS00320 Protein ID WP_137075820.1
Coordinates 80861..81229 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag PT747_RS00325 Protein ID WP_001520924.1
Coordinates 81226..81447 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PT747_RS00300 (76379) 76379..77449 - 1071 WP_011264401.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
PT747_RS00305 (77452) 77452..78297 - 846 WP_023235349.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PT747_RS00310 (78294) 78294..79181 - 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PT747_RS00315 (79286) 79286..80602 - 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PT747_RS00320 (80861) 80861..81229 - 369 WP_137075820.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PT747_RS00325 (81226) 81226..81447 - 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PT747_RS00330 (81578) 81578..82291 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PT747_RS00335 (82293) 82293..83060 - 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PT747_RS00340 (83057) 83057..84334 - 1278 WP_001541045.1 branched chain amino acid ABC transporter permease LivM -
PT747_RS00345 (84331) 84331..85257 - 927 WP_000003005.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PT747_RS00350 (85317) 85317..86420 - 1104 WP_023235350.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 75642..84334 8692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(25-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13603.88 Da        Isoelectric Point: 6.7252

>T272617 WP_137075820.1 NZ_CP117976:c81229-80861 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPSVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT272617 WP_001520924.1 NZ_CP117976:c81447-81226 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References