Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 1317454..1318040 | Replicon | chromosome |
Accession | NZ_CP117850 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F22R |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q57IR9 |
Locus tag | PTZ65_RS06450 | Protein ID | WP_000174963.1 |
Coordinates | 1317672..1318040 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | M7SDJ3 |
Locus tag | PTZ65_RS06445 | Protein ID | WP_001520924.1 |
Coordinates | 1317454..1317675 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTZ65_RS06420 (1312475) | 1312475..1313584 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
PTZ65_RS06425 (1313644) | 1313644..1314570 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PTZ65_RS06430 (1314567) | 1314567..1315844 | + | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
PTZ65_RS06435 (1315841) | 1315841..1316608 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
PTZ65_RS06440 (1316610) | 1316610..1317323 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
PTZ65_RS06445 (1317454) | 1317454..1317675 | + | 222 | WP_001520924.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PTZ65_RS06450 (1317672) | 1317672..1318040 | + | 369 | WP_000174963.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PTZ65_RS06455 (1318299) | 1318299..1319615 | + | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
PTZ65_RS06460 (1319720) | 1319720..1320607 | + | 888 | WP_000094074.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
PTZ65_RS06465 (1320604) | 1320604..1321449 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
PTZ65_RS06470 (1321452) | 1321452..1322522 | + | 1071 | WP_000907842.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1314567..1323259 | 8692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13573.85 Da Isoelectric Point: 6.7252
>T272346 WP_000174963.1 NZ_CP117850:1317672-1318040 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H6KCD5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z871 |