272346

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 1317454..1318040 Replicon chromosome
Accession NZ_CP117850
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F22R

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag PTZ65_RS06450 Protein ID WP_000174963.1
Coordinates 1317672..1318040 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag PTZ65_RS06445 Protein ID WP_001520924.1
Coordinates 1317454..1317675 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTZ65_RS06420 (1312475) 1312475..1313584 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PTZ65_RS06425 (1313644) 1313644..1314570 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PTZ65_RS06430 (1314567) 1314567..1315844 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PTZ65_RS06435 (1315841) 1315841..1316608 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PTZ65_RS06440 (1316610) 1316610..1317323 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PTZ65_RS06445 (1317454) 1317454..1317675 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PTZ65_RS06450 (1317672) 1317672..1318040 + 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PTZ65_RS06455 (1318299) 1318299..1319615 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PTZ65_RS06460 (1319720) 1319720..1320607 + 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PTZ65_RS06465 (1320604) 1320604..1321449 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PTZ65_RS06470 (1321452) 1321452..1322522 + 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1314567..1323259 8692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T272346 WP_000174963.1 NZ_CP117850:1317672-1318040 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT272346 WP_001520924.1 NZ_CP117850:1317454-1317675 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References