Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 329534..330120 | Replicon | chromosome |
Accession | NZ_CP117698 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain L1 |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q57IR9 |
Locus tag | PRJ38_RS01510 | Protein ID | WP_000174963.1 |
Coordinates | 329752..330120 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | V7IU48 |
Locus tag | PRJ38_RS01505 | Protein ID | WP_001522145.1 |
Coordinates | 329534..329755 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PRJ38_RS01480 (324555) | 324555..325664 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
PRJ38_RS01485 (325724) | 325724..326650 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PRJ38_RS01490 (326647) | 326647..327924 | + | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
PRJ38_RS01495 (327921) | 327921..328688 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
PRJ38_RS01500 (328690) | 328690..329403 | + | 714 | WP_058805605.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
PRJ38_RS01505 (329534) | 329534..329755 | + | 222 | WP_001522145.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PRJ38_RS01510 (329752) | 329752..330120 | + | 369 | WP_000174963.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PRJ38_RS01515 (330379) | 330379..331695 | + | 1317 | WP_000624749.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
PRJ38_RS01520 (331800) | 331800..332687 | + | 888 | WP_000094074.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
PRJ38_RS01525 (332684) | 332684..333529 | + | 846 | WP_023256946.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
PRJ38_RS01530 (333532) | 333532..334602 | + | 1071 | WP_000907838.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 302357..335339 | 32982 | |
inside | Prophage | - | - | 326647..335339 | 8692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13573.85 Da Isoelectric Point: 6.7252
>T272058 WP_000174963.1 NZ_CP117698:329752-330120 [Salmonella enterica subsp. enterica serovar London]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|