Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 330600..331186 Replicon chromosome
Accession NZ_CP117696
Organism Salmonella enterica subsp. enterica serovar London strain F1

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag PTQ22_RS01520 Protein ID WP_000174963.1
Coordinates 330818..331186 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag PTQ22_RS01515 Protein ID WP_001522145.1
Coordinates 330600..330821 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTQ22_RS01490 (325621) 325621..326730 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PTQ22_RS01495 (326790) 326790..327716 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PTQ22_RS01500 (327713) 327713..328990 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PTQ22_RS01505 (328987) 328987..329754 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PTQ22_RS01510 (329756) 329756..330469 + 714 WP_058805605.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PTQ22_RS01515 (330600) 330600..330821 + 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PTQ22_RS01520 (330818) 330818..331186 + 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PTQ22_RS01525 (331445) 331445..332761 + 1317 WP_000624749.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PTQ22_RS01530 (332866) 332866..333753 + 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PTQ22_RS01535 (333750) 333750..334595 + 846 WP_023256946.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PTQ22_RS01540 (334598) 334598..335668 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 327713..336405 8692
- inside Prophage - - 325621..336405 10784


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T272041 WP_000174963.1 NZ_CP117696:330818-331186 [Salmonella enterica subsp. enterica serovar London]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT272041 WP_001522145.1 NZ_CP117696:330600-330821 [Salmonella enterica subsp. enterica serovar London]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure

References