271191

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 317157..317743 Replicon chromosome
Accession NZ_CP117404
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain RM085

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag PQQ07_RS01455 Protein ID WP_001521773.1
Coordinates 317375..317743 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag PQQ07_RS01450 Protein ID WP_001520924.1
Coordinates 317157..317378 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ07_RS01425 (312177) 312177..313286 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PQQ07_RS01430 (313346) 313346..314272 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQQ07_RS01435 (314269) 314269..315546 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
PQQ07_RS01440 (315543) 315543..316310 + 768 WP_274896207.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQQ07_RS01445 (316312) 316312..317025 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQQ07_RS01450 (317157) 317157..317378 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQQ07_RS01455 (317375) 317375..317743 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQQ07_RS01460 (318002) 318002..319318 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQQ07_RS01465 (319382) 319382..320269 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQQ07_RS01470 (320266) 320266..321111 + 846 WP_128297892.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQQ07_RS01475 (321113) 321113..322183 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 314269..322920 8651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T271191 WP_001521773.1 NZ_CP117404:317375-317743 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT271191 WP_001520924.1 NZ_CP117404:317157-317378 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References