Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 317218..317804 Replicon chromosome
Accession NZ_CP117400
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain RM014

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag PQP96_RS01455 Protein ID WP_001521773.1
Coordinates 317436..317804 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag PQP96_RS01450 Protein ID WP_001520924.1
Coordinates 317218..317439 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP96_RS01425 (312238) 312238..313347 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PQP96_RS01430 (313407) 313407..314333 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQP96_RS01435 (314330) 314330..315607 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
PQP96_RS01440 (315604) 315604..316371 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQP96_RS01445 (316373) 316373..317086 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQP96_RS01450 (317218) 317218..317439 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQP96_RS01455 (317436) 317436..317804 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQP96_RS01460 (318063) 318063..319379 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQP96_RS01465 (319443) 319443..320330 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQP96_RS01470 (320327) 320327..321172 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQP96_RS01475 (321174) 321174..322244 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 314330..322981 8651
inside Prophage - - 315604..322981 7377


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T271158 WP_001521773.1 NZ_CP117400:317436-317804 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT271158 WP_001520924.1 NZ_CP117400:317218-317439 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References