Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 312517..313103 | Replicon | chromosome |
Accession | NZ_CP117380 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain RM037 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A0R9MYB2 |
Locus tag | PQP93_RS01430 | Protein ID | WP_000174966.1 |
Coordinates | 312735..313103 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A0R9PI96 |
Locus tag | PQP93_RS01425 | Protein ID | WP_001535398.1 |
Coordinates | 312517..312738 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP93_RS01400 (307537) | 307537..308646 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
PQP93_RS01405 (308706) | 308706..309632 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PQP93_RS01410 (309629) | 309629..310906 | + | 1278 | WP_274890205.1 | branched chain amino acid ABC transporter permease LivM | - |
PQP93_RS01415 (310903) | 310903..311670 | + | 768 | WP_274890206.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
PQP93_RS01420 (311672) | 311672..312385 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
PQP93_RS01425 (312517) | 312517..312738 | + | 222 | WP_001535398.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQP93_RS01430 (312735) | 312735..313103 | + | 369 | WP_000174966.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PQP93_RS01435 (313362) | 313362..314676 | + | 1315 | Protein_282 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
PQP93_RS01440 (314781) | 314781..315668 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
PQP93_RS01445 (315665) | 315665..316510 | + | 846 | WP_274890207.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
PQP93_RS01450 (316513) | 316513..317583 | + | 1071 | WP_000907845.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 309629..318320 | 8691 | ||
- | inside | Prophage | - | - | 310903..318320 | 7417 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13629.91 Da Isoelectric Point: 6.4657
>T270955 WP_000174966.1 NZ_CP117380:312735-313103 [Salmonella enterica subsp. enterica serovar Newport]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9MYB2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PI96 |