Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 312527..313113 Replicon chromosome
Accession NZ_CP117376
Organism Salmonella enterica subsp. enterica serovar Newport strain RM041

Toxin (Protein)


Gene name doc Uniprot ID A0A0R9MYB2
Locus tag PQQ16_RS01425 Protein ID WP_000174966.1
Coordinates 312745..313113 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0R9PI96
Locus tag PQQ16_RS01420 Protein ID WP_001535398.1
Coordinates 312527..312748 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ16_RS01395 (307547) 307547..308656 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PQQ16_RS01400 (308716) 308716..309642 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQQ16_RS01405 (309639) 309639..310916 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
PQQ16_RS01410 (310913) 310913..311680 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQQ16_RS01415 (311682) 311682..312395 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQQ16_RS01420 (312527) 312527..312748 + 222 WP_001535398.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQQ16_RS01425 (312745) 312745..313113 + 369 WP_000174966.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQQ16_RS01430 (313372) 313372..314688 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQQ16_RS01435 (314793) 314793..315680 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQQ16_RS01440 (315677) 315677..316522 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQQ16_RS01445 (316525) 316525..317595 + 1071 WP_000907845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 309639..318332 8693


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13629.91 Da        Isoelectric Point: 6.4657

>T270924 WP_000174966.1 NZ_CP117376:312745-313113 [Salmonella enterica subsp. enterica serovar Newport]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.23 Da        Isoelectric Point: 6.4643

>AT270924 WP_001535398.1 NZ_CP117376:312527-312748 [Salmonella enterica subsp. enterica serovar Newport]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9MYB2

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PI96

References