Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 312525..313111 Replicon chromosome
Accession NZ_CP117365
Organism Salmonella enterica subsp. enterica serovar Newport strain RM089

Toxin (Protein)


Gene name doc Uniprot ID A0A0R9MYB2
Locus tag PQP78_RS01425 Protein ID WP_000174966.1
Coordinates 312743..313111 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0R9PI96
Locus tag PQP78_RS01420 Protein ID WP_001535398.1
Coordinates 312525..312746 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP78_RS01395 (307545) 307545..308654 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PQP78_RS01400 (308714) 308714..309640 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQP78_RS01405 (309637) 309637..310914 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
PQP78_RS01410 (310911) 310911..311678 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQP78_RS01415 (311680) 311680..312393 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQP78_RS01420 (312525) 312525..312746 + 222 WP_001535398.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQP78_RS01425 (312743) 312743..313111 + 369 WP_000174966.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQP78_RS01430 (313370) 313370..314686 + 1317 WP_274891917.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQP78_RS01435 (314791) 314791..315678 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQP78_RS01440 (315675) 315675..316520 + 846 WP_128297892.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQP78_RS01445 (316523) 316523..317593 + 1071 WP_000907845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 309637..318330 8693


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13629.91 Da        Isoelectric Point: 6.4657

>T270828 WP_000174966.1 NZ_CP117365:312743-313111 [Salmonella enterica subsp. enterica serovar Newport]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.23 Da        Isoelectric Point: 6.4643

>AT270828 WP_001535398.1 NZ_CP117365:312525-312746 [Salmonella enterica subsp. enterica serovar Newport]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9MYB2

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PI96

References