Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 316503..317089 Replicon chromosome
Accession NZ_CP117338
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain RM095

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag PQP94_RS01450 Protein ID WP_001521773.1
Coordinates 316721..317089 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag PQP94_RS01445 Protein ID WP_001520924.1
Coordinates 316503..316724 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP94_RS01420 (311523) 311523..312632 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PQP94_RS01425 (312692) 312692..313618 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQP94_RS01430 (313615) 313615..314892 + 1278 WP_001742325.1 branched chain amino acid ABC transporter permease LivM -
PQP94_RS01435 (314889) 314889..315656 + 768 WP_274895818.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQP94_RS01440 (315658) 315658..316371 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQP94_RS01445 (316503) 316503..316724 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQP94_RS01450 (316721) 316721..317089 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQP94_RS01455 (317348) 317348..318664 + 1317 WP_274895819.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQP94_RS01460 (318728) 318728..319615 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQP94_RS01465 (319612) 319612..320457 + 846 WP_274895820.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQP94_RS01470 (320459) 320459..321529 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 313615..322266 8651
inside Prophage - - 314889..322266 7377


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T270607 WP_001521773.1 NZ_CP117338:316721-317089 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT270607 WP_001520924.1 NZ_CP117338:316503-316724 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References