Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 316398..316984 Replicon chromosome
Accession NZ_CP117327
Organism Salmonella enterica subsp. enterica serovar Saintpaul strain RM106

Toxin (Protein)


Gene name doc Uniprot ID A0A5V1HI31
Locus tag PQP95_RS01460 Protein ID WP_000174965.1
Coordinates 316616..316984 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A8F2ZY79
Locus tag PQP95_RS01455 Protein ID WP_001599562.1
Coordinates 316398..316619 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP95_RS01430 (311418) 311418..312527 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PQP95_RS01435 (312587) 312587..313513 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQP95_RS01440 (313510) 313510..314787 + 1278 WP_274879228.1 branched chain amino acid ABC transporter permease LivM -
PQP95_RS01445 (314784) 314784..315551 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQP95_RS01450 (315553) 315553..316266 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQP95_RS01455 (316398) 316398..316619 + 222 WP_001599562.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQP95_RS01460 (316616) 316616..316984 + 369 WP_000174965.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQP95_RS01465 (317243) 317243..318559 + 1317 Protein_288 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQP95_RS01470 (318664) 318664..319551 + 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQP95_RS01475 (319548) 319548..320393 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQP95_RS01480 (320395) 320395..321465 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 313510..322202 8692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13599.89 Da        Isoelectric Point: 6.4657

>T270522 WP_000174965.1 NZ_CP117327:316616-316984 [Salmonella enterica subsp. enterica serovar Saintpaul]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.20 Da        Isoelectric Point: 6.4643

>AT270522 WP_001599562.1 NZ_CP117327:316398-316619 [Salmonella enterica subsp. enterica serovar Saintpaul]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5V1HI31

Antitoxin

Source ID Structure

References