Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 323445..324031 Replicon chromosome
Accession NZ_CP117326
Organism Salmonella enterica subsp. enterica serovar Newport strain RM108

Toxin (Protein)


Gene name doc Uniprot ID A0A0R9MYB2
Locus tag PQQ05_RS01495 Protein ID WP_000174966.1
Coordinates 323663..324031 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0R9PI96
Locus tag PQQ05_RS01490 Protein ID WP_001535398.1
Coordinates 323445..323666 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ05_RS01465 (318465) 318465..319574 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PQQ05_RS01470 (319634) 319634..320560 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQQ05_RS01475 (320557) 320557..321834 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
PQQ05_RS01480 (321831) 321831..322598 + 768 WP_274895452.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQQ05_RS01485 (322600) 322600..323313 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQQ05_RS01490 (323445) 323445..323666 + 222 WP_001535398.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQQ05_RS01495 (323663) 323663..324031 + 369 WP_000174966.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQQ05_RS01500 (324290) 324290..325606 + 1317 Protein_295 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQQ05_RS01505 (325711) 325711..326598 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQQ05_RS01510 (326595) 326595..327440 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQQ05_RS01515 (327443) 327443..328513 + 1071 WP_000907845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 320557..329250 8693
- inside Prophage - - 313223..329250 16027


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13629.91 Da        Isoelectric Point: 6.4657

>T270506 WP_000174966.1 NZ_CP117326:323663-324031 [Salmonella enterica subsp. enterica serovar Newport]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.23 Da        Isoelectric Point: 6.4643

>AT270506 WP_001535398.1 NZ_CP117326:323445-323666 [Salmonella enterica subsp. enterica serovar Newport]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9MYB2

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PI96

References