Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4475238..4475824 Replicon chromosome
Accession NZ_CP117184
Organism Salmonella enterica subsp. enterica strain 123

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag PQ453_RS22210 Protein ID WP_001521773.1
Coordinates 4475238..4475606 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag PQ453_RS22215 Protein ID WP_001520924.1
Coordinates 4475603..4475824 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQ453_RS22190 (4470798) 4470798..4471868 - 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
PQ453_RS22195 (4471870) 4471870..4472715 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQ453_RS22200 (4472712) 4472712..4473599 - 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQ453_RS22205 (4473663) 4473663..4474979 - 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQ453_RS22210 (4475238) 4475238..4475606 - 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQ453_RS22215 (4475603) 4475603..4475824 - 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQ453_RS22220 (4475956) 4475956..4476669 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQ453_RS22225 (4476671) 4476671..4477438 - 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQ453_RS22230 (4477435) 4477435..4478712 - 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
PQ453_RS22235 (4478709) 4478709..4479635 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQ453_RS22240 (4479695) 4479695..4480804 - 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4470061..4478712 8651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T270054 WP_001521773.1 NZ_CP117184:c4475606-4475238 [Salmonella enterica subsp. enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT270054 WP_001520924.1 NZ_CP117184:c4475824-4475603 [Salmonella enterica subsp. enterica]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References