Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3715059..3715873 | Replicon | chromosome |
| Accession | NZ_CP117184 | ||
| Organism | Salmonella enterica subsp. enterica strain 123 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | Q57KM2 |
| Locus tag | PQ453_RS18455 | Protein ID | WP_000971655.1 |
| Coordinates | 3715346..3715873 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | E8XL32 |
| Locus tag | PQ453_RS18450 | Protein ID | WP_000855692.1 |
| Coordinates | 3715059..3715349 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ453_RS18420 (3711009) | 3711009..3711659 | - | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
| PQ453_RS18425 (3712116) | 3712116..3712559 | + | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| PQ453_RS18430 (3712990) | 3712990..3713439 | + | 450 | WP_000381610.1 | membrane protein | - |
| PQ453_RS18435 (3713424) | 3713424..3713771 | + | 348 | WP_001669174.1 | DUF1493 family protein | - |
| PQ453_RS18440 (3714044) | 3714044..3714370 | - | 327 | WP_000393302.1 | hypothetical protein | - |
| PQ453_RS18445 (3714611) | 3714611..3714789 | + | 179 | Protein_3598 | IS3 family transposase | - |
| PQ453_RS18450 (3715059) | 3715059..3715349 | + | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
| PQ453_RS18455 (3715346) | 3715346..3715873 | + | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
| PQ453_RS18460 (3715946) | 3715946..3716151 | - | 206 | Protein_3601 | IS5/IS1182 family transposase | - |
| PQ453_RS18465 (3716498) | 3716498..3717154 | + | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| PQ453_RS18470 (3717326) | 3717326..3717847 | - | 522 | WP_000858988.1 | hypothetical protein | - |
| PQ453_RS18475 (3718006) | 3718006..3720573 | + | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 3715946..3716122 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T270050 WP_000971655.1 NZ_CP117184:3715346-3715873 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6G96 | |
| PDB | 7AK9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK9 | |
| AlphaFold DB | A0A625WHV3 |