Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2075417..2076003 | Replicon | chromosome |
| Accession | NZ_CP117181 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28S | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | Q57IR9 |
| Locus tag | PQP75_RS09960 | Protein ID | WP_000174963.1 |
| Coordinates | 2075635..2076003 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | M7SDJ3 |
| Locus tag | PQP75_RS09955 | Protein ID | WP_001520924.1 |
| Coordinates | 2075417..2075638 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP75_RS09930 (2070438) | 2070438..2071547 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| PQP75_RS09935 (2071607) | 2071607..2072533 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PQP75_RS09940 (2072530) | 2072530..2073807 | + | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
| PQP75_RS09945 (2073804) | 2073804..2074571 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| PQP75_RS09950 (2074573) | 2074573..2075286 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| PQP75_RS09955 (2075417) | 2075417..2075638 | + | 222 | WP_001520924.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQP75_RS09960 (2075635) | 2075635..2076003 | + | 369 | WP_000174963.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PQP75_RS09965 (2076262) | 2076262..2077578 | + | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| PQP75_RS09970 (2077683) | 2077683..2078570 | + | 888 | WP_000094074.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| PQP75_RS09975 (2078567) | 2078567..2079412 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| PQP75_RS09980 (2079415) | 2079415..2080485 | + | 1071 | WP_000907842.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2072530..2081222 | 8692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13573.85 Da Isoelectric Point: 6.7252
>T270027 WP_000174963.1 NZ_CP117181:2075635-2076003 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H6KCD5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z871 |