Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2075417..2076003 Replicon chromosome
Accession NZ_CP117181
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28S

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag PQP75_RS09960 Protein ID WP_000174963.1
Coordinates 2075635..2076003 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag PQP75_RS09955 Protein ID WP_001520924.1
Coordinates 2075417..2075638 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP75_RS09930 (2070438) 2070438..2071547 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PQP75_RS09935 (2071607) 2071607..2072533 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQP75_RS09940 (2072530) 2072530..2073807 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PQP75_RS09945 (2073804) 2073804..2074571 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQP75_RS09950 (2074573) 2074573..2075286 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQP75_RS09955 (2075417) 2075417..2075638 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQP75_RS09960 (2075635) 2075635..2076003 + 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQP75_RS09965 (2076262) 2076262..2077578 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQP75_RS09970 (2077683) 2077683..2078570 + 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQP75_RS09975 (2078567) 2078567..2079412 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQP75_RS09980 (2079415) 2079415..2080485 + 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2072530..2081222 8692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T270027 WP_000174963.1 NZ_CP117181:2075635-2076003 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT270027 WP_001520924.1 NZ_CP117181:2075417-2075638 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References