Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 3999698..4000512 | Replicon | chromosome |
| Accession | NZ_CP114896 | ||
| Organism | Escherichia coli strain CM93 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | O6117_RS19515 | Protein ID | WP_001054376.1 |
| Coordinates | 4000255..4000512 (-) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | U9Z4B8 |
| Locus tag | O6117_RS19510 | Protein ID | WP_001309181.1 |
| Coordinates | 3999698..4000243 (-) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6117_RS19480 (3995389) | 3995389..3996702 | - | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
| O6117_RS19485 (3996714) | 3996714..3996992 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
| O6117_RS19490 (3996989) | 3996989..3998110 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
| O6117_RS19495 (3998355) | 3998355..3998471 | - | 117 | Protein_3789 | VOC family protein | - |
| O6117_RS19500 (3998509) | 3998509..3998727 | - | 219 | Protein_3790 | hypothetical protein | - |
| O6117_RS19505 (3998896) | 3998896..3999642 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| O6117_RS19510 (3999698) | 3999698..4000243 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
| O6117_RS19515 (4000255) | 4000255..4000512 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
| O6117_RS19520 (4001003) | 4001003..4001134 | - | 132 | WP_001309182.1 | hypothetical protein | - |
| O6117_RS19525 (4001250) | 4001250..4002490 | + | 1241 | Protein_3795 | helicase YjhR | - |
| O6117_RS19530 (4002758) | 4002758..4002963 | - | 206 | Protein_3796 | HNH endonuclease | - |
| O6117_RS19535 (4003073) | 4003073..4004053 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| O6117_RS19540 (4004118) | 4004118..4005224 | - | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 3999698..4015950 | 16252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T267037 WP_001054376.1 NZ_CP114896:c4000512-4000255 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT267037 WP_001309181.1 NZ_CP114896:c4000243-3999698 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|