Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 2233530..2234197 | Replicon | chromosome |
Accession | NZ_CP114896 | ||
Organism | Escherichia coli strain CM93 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | O6117_RS11000 | Protein ID | WP_001094400.1 |
Coordinates | 2233868..2234197 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | O6117_RS10995 | Protein ID | WP_000072690.1 |
Coordinates | 2233530..2233847 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6117_RS10965 (2228582) | 2228582..2229591 | - | 1010 | Protein_2140 | arsenic transporter | - |
O6117_RS10970 (2229733) | 2229733..2231436 | + | 1704 | WP_000896263.1 | protein YfjW | - |
O6117_RS10975 (2232047) | 2232047..2232231 | + | 185 | Protein_2142 | DUF905 family protein | - |
O6117_RS10980 (2232334) | 2232334..2232792 | + | 459 | WP_000211841.1 | antirestriction protein | - |
O6117_RS10985 (2232801) | 2232801..2233283 | + | 483 | WP_001407480.1 | RadC family protein | - |
O6117_RS10990 (2233292) | 2233292..2233492 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
O6117_RS10995 (2233530) | 2233530..2233847 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
O6117_RS11000 (2233868) | 2233868..2234197 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
O6117_RS11005 (2234561) | 2234561..2239141 | - | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2212574..2254459 | 41885 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T267029 WP_001094400.1 NZ_CP114896:2233868-2234197 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2EA9 | |
PDB | 2JN7 | |
AlphaFold DB | P52141 |