Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 611516..612330 | Replicon | chromosome |
Accession | NZ_CP114895 | ||
Organism | Escherichia coli strain CM56 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | O6106_RS02920 | Protein ID | WP_001054376.1 |
Coordinates | 612073..612330 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | O6106_RS02915 | Protein ID | WP_001309181.1 |
Coordinates | 611516..612061 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6106_RS02885 (607207) | 607207..608520 | - | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
O6106_RS02890 (608532) | 608532..608810 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
O6106_RS02895 (608807) | 608807..609928 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
O6106_RS02900 (610173) | 610173..610289 | - | 117 | Protein_547 | VOC family protein | - |
O6106_RS02905 (610327) | 610327..610545 | - | 219 | Protein_548 | hypothetical protein | - |
O6106_RS02910 (610714) | 610714..611460 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
O6106_RS02915 (611516) | 611516..612061 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
O6106_RS02920 (612073) | 612073..612330 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
O6106_RS02925 (612821) | 612821..612952 | - | 132 | WP_001309182.1 | hypothetical protein | - |
O6106_RS02930 (613068) | 613068..614308 | + | 1241 | Protein_553 | helicase YjhR | - |
O6106_RS02935 (614576) | 614576..614781 | - | 206 | Protein_554 | HNH endonuclease | - |
O6106_RS02940 (614891) | 614891..615871 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
O6106_RS02945 (615936) | 615936..617042 | - | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 611516..627768 | 16252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T266992 WP_001054376.1 NZ_CP114895:c612330-612073 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT266992 WP_001309181.1 NZ_CP114895:c612061-611516 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|