Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 2338164..2338831 | Replicon | chromosome |
| Accession | NZ_CP114893 | ||
| Organism | Escherichia coli strain CM13 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | Q46953 |
| Locus tag | O6R07_RS11400 | Protein ID | WP_001094400.1 |
| Coordinates | 2338164..2338493 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | P52141 |
| Locus tag | O6R07_RS11405 | Protein ID | WP_000072690.1 |
| Coordinates | 2338514..2338831 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6R07_RS11395 (2333220) | 2333220..2337800 | + | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
| O6R07_RS11400 (2338164) | 2338164..2338493 | - | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
| O6R07_RS11405 (2338514) | 2338514..2338831 | - | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| O6R07_RS11410 (2338869) | 2338869..2339069 | - | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
| O6R07_RS11415 (2339078) | 2339078..2339560 | - | 483 | WP_001407480.1 | RadC family protein | - |
| O6R07_RS11420 (2339569) | 2339569..2340027 | - | 459 | WP_000211841.1 | antirestriction protein | - |
| O6R07_RS11425 (2340130) | 2340130..2340353 | - | 224 | Protein_2214 | DUF905 family protein | - |
| O6R07_RS11430 (2340925) | 2340925..2342628 | - | 1704 | WP_000896263.1 | protein YfjW | - |
| O6R07_RS11435 (2342770) | 2342770..2343779 | + | 1010 | Protein_2216 | arsenic transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 2323387..2360392 | 37005 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T266953 WP_001094400.1 NZ_CP114893:c2338493-2338164 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A373F4I3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2EA9 | |
| PDB | 2JN7 | |
| AlphaFold DB | P52141 |