Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3767291..3768105 | Replicon | chromosome |
Accession | NZ_CP114892 | ||
Organism | Escherichia coli strain CM5 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | O6Q95_RS18405 | Protein ID | WP_001054376.1 |
Coordinates | 3767848..3768105 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | O6Q95_RS18400 | Protein ID | WP_001309181.1 |
Coordinates | 3767291..3767836 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6Q95_RS18370 (3762982) | 3762982..3764295 | - | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
O6Q95_RS18375 (3764307) | 3764307..3764585 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
O6Q95_RS18380 (3764582) | 3764582..3765703 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
O6Q95_RS18385 (3765948) | 3765948..3766064 | - | 117 | Protein_3582 | VOC family protein | - |
O6Q95_RS18390 (3766102) | 3766102..3766320 | - | 219 | Protein_3583 | hypothetical protein | - |
O6Q95_RS18395 (3766489) | 3766489..3767235 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
O6Q95_RS18400 (3767291) | 3767291..3767836 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
O6Q95_RS18405 (3767848) | 3767848..3768105 | - | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
O6Q95_RS18410 (3768596) | 3768596..3768727 | - | 132 | WP_001309182.1 | hypothetical protein | - |
O6Q95_RS18415 (3768843) | 3768843..3770083 | + | 1241 | Protein_3588 | helicase YjhR | - |
O6Q95_RS18420 (3770351) | 3770351..3770556 | - | 206 | Protein_3589 | HNH endonuclease | - |
O6Q95_RS18425 (3770666) | 3770666..3771646 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
O6Q95_RS18430 (3771711) | 3771711..3772817 | - | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3767291..3783543 | 16252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T266936 WP_001054376.1 NZ_CP114892:c3768105-3767848 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT266936 WP_001309181.1 NZ_CP114892:c3767836-3767291 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|