266007

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 346606..347192 Replicon chromosome
Accession NZ_CP113541
Organism Salmonella enterica strain CHC

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag OXV05_RS01580 Protein ID WP_001521773.1
Coordinates 346824..347192 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag OXV05_RS01575 Protein ID WP_001520924.1
Coordinates 346606..346827 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OXV05_RS01550 (341626) 341626..342735 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
OXV05_RS01555 (342795) 342795..343721 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OXV05_RS01560 (343718) 343718..344995 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
OXV05_RS01565 (344992) 344992..345759 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OXV05_RS01570 (345761) 345761..346474 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OXV05_RS01575 (346606) 346606..346827 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OXV05_RS01580 (346824) 346824..347192 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OXV05_RS01585 (347451) 347451..348767 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OXV05_RS01590 (348831) 348831..349718 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OXV05_RS01595 (349715) 349715..350560 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OXV05_RS01600 (350562) 350562..351632 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 343718..352369 8651


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T266007 WP_001521773.1 NZ_CP113541:346824-347192 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT266007 WP_001520924.1 NZ_CP113541:346606-346827 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References