Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 310612..311198 | Replicon | chromosome |
| Accession | NZ_CP113534 | ||
| Organism | Salmonella enterica strain ZYX | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A3V9X0E4 |
| Locus tag | OXV08_RS01420 | Protein ID | WP_000174964.1 |
| Coordinates | 310830..311198 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | V7IU48 |
| Locus tag | OXV08_RS01415 | Protein ID | WP_001522145.1 |
| Coordinates | 310612..310833 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV08_RS01390 (305633) | 305633..306742 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| OXV08_RS01395 (306802) | 306802..307728 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| OXV08_RS01400 (307725) | 307725..309002 | + | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
| OXV08_RS01405 (308999) | 308999..309766 | + | 768 | WP_000082080.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| OXV08_RS01410 (309768) | 309768..310481 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| OXV08_RS01415 (310612) | 310612..310833 | + | 222 | WP_001522145.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OXV08_RS01420 (310830) | 310830..311198 | + | 369 | WP_000174964.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| OXV08_RS01425 (311457) | 311457..312773 | + | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| OXV08_RS01430 (312878) | 312878..313765 | + | 888 | WP_080196941.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| OXV08_RS01435 (313762) | 313762..314607 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| OXV08_RS01440 (314609) | 314609..315679 | + | 1071 | WP_000907842.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 307725..316416 | 8691 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13601.91 Da Isoelectric Point: 6.7252
>T265881 WP_000174964.1 NZ_CP113534:310830-311198 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|