265881

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 310612..311198 Replicon chromosome
Accession NZ_CP113534
Organism Salmonella enterica strain ZYX

Toxin (Protein)


Gene name doc Uniprot ID A0A3V9X0E4
Locus tag OXV08_RS01420 Protein ID WP_000174964.1
Coordinates 310830..311198 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag OXV08_RS01415 Protein ID WP_001522145.1
Coordinates 310612..310833 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OXV08_RS01390 (305633) 305633..306742 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
OXV08_RS01395 (306802) 306802..307728 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OXV08_RS01400 (307725) 307725..309002 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
OXV08_RS01405 (308999) 308999..309766 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OXV08_RS01410 (309768) 309768..310481 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OXV08_RS01415 (310612) 310612..310833 + 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OXV08_RS01420 (310830) 310830..311198 + 369 WP_000174964.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OXV08_RS01425 (311457) 311457..312773 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OXV08_RS01430 (312878) 312878..313765 + 888 WP_080196941.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OXV08_RS01435 (313762) 313762..314607 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OXV08_RS01440 (314609) 314609..315679 + 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 307725..316416 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-114)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13601.91 Da        Isoelectric Point: 6.7252

>T265881 WP_000174964.1 NZ_CP113534:310830-311198 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT265881 WP_001522145.1 NZ_CP113534:310612-310833 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V9X0E4

Antitoxin

Source ID Structure

References